CAZyme Information: ASPSYDRAFT_29504-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_29504-t33_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544		60363.76	4.6512

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878584:1787632-1789336(-)

Full Sequence      

MRTGGFLYSALSIMPLATQALAQTYSEPYRPQYHFTPARGWINDPNGLVYADGTYHMFYQ
YNPGGTGHGNVSWGHATSEDLTHWDERPVALLARGFPGNVSEMFFSGSAVVDVQNTSGFS
VGGESPMIAMYTSYYPVSQTLPSGKRVRTDQQSQSIAYSLDQGETWTTYDEANPVILEPP
VPYKDQYKEFRDPNVFWHEETGKWVLVTALSKLHKLLIYTSDNLKDWSFASEFGPYNAVG
GVWECPSFFPLPVDGDESNVKWVAIIGLNPGGPPGTVGSGNQYILGQFNGTTFIPDKESI
HTSGVANWFDYGPDFYAALVYNGQPEYQRTVITWMNNWQYSEKIPTSSWRGAMAIPRKLA
LKTVNGNVTLAQEPEEDWDAITSNAHTSRFESLPEGIHNLGSLGKALEINLTFSDRNTNP
SSSRSPSEFGISLRATQNFTQQTRIGYDFATEQVFVDRRRSGNSSFDETFASIYHAPLSP
AEDGTVALRIFVDWSSVEVFGGQGETTVTAQIFPDERAAYARLFSSGGSTDNVHLSVKEV
ESVW

Enzyme Prediction     

EC	3.2.1.80:10	3.2.1.65:10	3.2.1.26:7	3.2.1.153:5	3.2.1.64:3	2.4.1.99:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	34	374	3.1e-93	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
350134	GH32_Inu-like	1.19e-149	39	361	1	289	glycoside hydrolase family 32 protein such as Aspergillus ficuum endo-inulinase (Inu2). This subfamily of glycosyl hydrolase family GH32 includes endo-inulinase (inu2, EC 3.2.1.7), exo-inulinase (Inu1, EC 3.2.1.80), invertase (EC 3.2.1.26), and levan fructotransferase (LftA, EC 4.2.2.16), among others. These enzymes cleave sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
214757	Glyco_32	1.78e-138	34	504	1	437	Glycosyl hydrolases family 32.
224536	SacC	3.80e-121	23	529	22	474	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
395193	Glyco_hydro_32N	3.45e-109	34	374	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
350093	GH_J	1.44e-83	43	360	1	292	Glycosyl hydrolase families 32 and 68, which form the clan GH-J. This glycosyl hydrolase family clan J (according to carbohydrate-active enzymes database (CAZY)) includes family 32 (GH32) and 68 (GH68). GH32 enzymes include invertase (EC 3.2.1.26) and other other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). The GH68 family consists of frucosyltransferases (FTFs) that include levansucrase (EC 2.4.1.10, also known as beta-D-fructofuranosyl transferase), beta-fructofuranosidase (EC 3.2.1.26) and inulosucrase (EC 2.4.1.9). GH32 and GH68 family enzymes are retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) and catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS22581.1|GH32	0.0	1	544	1	544
EAA61090.1|GH32	5.57e-279	9	544	671	1202
QKX59933.1|GH32	3.32e-270	24	544	23	556
AAP00519.1|GH32	1.72e-252	9	544	6	542
AAP00520.1|GH32	2.86e-251	25	544	3	523

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1Y4W_A	2.81e-241	25	544	3	517	Crystal structure of exo-inulinase from Aspergillus awamori in spacegroup P21 [Aspergillus awamori],1Y9G_A Crystal structure of exo-inulinase from Aspergillus awamori complexed with fructose [Aspergillus awamori],1Y9M_A Crystal structure of exo-inulinase from Aspergillus awamori in spacegroup P212121 [Aspergillus awamori]
3RWK_X	1.24e-85	22	543	21	513	First crystal structure of an endo-inulinase, from Aspergillus ficuum: structural analysis and comparison with other GH32 enzymes. [Aspergillus ficuum],3SC7_X First crystal structure of an endo-inulinase, from Aspergillus ficuum: structural analysis and comparison with other GH32 enzymes. [Aspergillus ficuum]
3KF3_A	3.85e-81	26	516	6	479	Chain A, Invertase [Schwanniomyces occidentalis],3KF3_B Chain B, Invertase [Schwanniomyces occidentalis]
3KF5_A	4.16e-81	26	516	9	482	Chain A, Invertase [Schwanniomyces occidentalis],3KF5_B Chain B, Invertase [Schwanniomyces occidentalis]
3U75_A	5.72e-80	26	516	32	505	Chain A, Fructofuranosidase [Schwanniomyces occidentalis],3U75_B Chain B, Fructofuranosidase [Schwanniomyces occidentalis],3U75_C Chain C, Fructofuranosidase [Schwanniomyces occidentalis],3U75_D Chain D, Fructofuranosidase [Schwanniomyces occidentalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q76HP6|INUE_ASPNG	1.13e-244	7	544	4	536	Extracellular exo-inulinase inuE OS=Aspergillus niger OX=5061 GN=inuE PE=1 SV=1
sp|E1ABX2|INUE_ASPFI	1.13e-244	7	544	4	536	Extracellular exo-inulinase inuE OS=Aspergillus ficuum OX=5058 GN=exoI PE=1 SV=1
sp|A2R0E0|INUE_ASPNC	3.73e-243	7	544	4	536	Extracellular exo-inulinase inuE OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=inuE PE=2 SV=1
sp|Q96TU3|INUE_ASPAW	3.04e-242	7	544	4	536	Extracellular exo-inulinase inuE OS=Aspergillus awamori OX=105351 GN=inuE PE=1 SV=1
sp|K0E4E1|ECDE_ASPRU	9.60e-223	12	544	15	702	Putative glycosyl hydrolase ecdE OS=Aspergillus rugulosus OX=41736 GN=ecdE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000223	0.999731	CS pos: 22-23. Pr: 0.9741

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_29504-t33_1-p1.