CAZyme Information: ASPSYDRAFT_211169-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_211169-t33_1-p1
• CAZy Family: GH15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
618	KV878595|CGC2	66424.93	6.2427

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878595:711176-713211(-)

Full Sequence      

MKPSFLSALVSLAFSCCGNAAGIPSFGTIVARETDLLPEYDYVVVGGGVGGLVVANRLSE
DPDTTVLVIEAGKIDNYTDVVQYPRYASIARTNYSWPITSLPVPALNNRTSSVASARVLG
GGSAINGMAFDRGSPGDYNLWGELIEDDAWSWEGLLPYFKKSETFTPPTEAQQRKLGITF
DLDAHGTSGPVQSSYPPWISITGKAFIDALRQLHIPIQLDGTANAIGGFWNPNSLNPVAR
ERSYARTTFHEIAKSRPNYHVLPETLVTNLTPDLSSVEYITGYNPSVKASPRDTKRSQAR
KEIILAAGALHTPKILQLSGIGSSSVLKSLGIKQVLDIPGVGENFQDHPVVYGAMDLTNL
DDPTQDPSYLSTNATYDAAMGQLYERNRTGPWTFSTSNVFAFLTAQHLNVSSAAIAHAAS
EPAEKYLRAGLDSTIIHGYEKVKSAVLKSTAEGKIALTENLFGSVASLQKPLSRGSVHAA
STDPYKMPSVDYRSFTNPLDLQVLVQSLRFNSDVISQTRAYKAIGAVVQTPESGLSDKEL
VELVRTAGVPSFSHPSGSCAMLKLEDGGCVDNKLRLYGSEGRVRVVDASIFPVVPSTHTQ
STVYAVAEKAADIIKGVE

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_211169-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	39	615	1.5e-161	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.19e-79	55	616	23	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	4.02e-79	55	616	21	533	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.55e-32	471	610	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.34e-25	104	350	12	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.99e-13	300	603	279	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS29283.1|AA3_2	3.40e-288	24	617	21	615
CCA74023.1|AA3_2	9.91e-142	1	609	1	605
BCS29521.1|AA3_2	6.54e-135	24	615	27	618
CEI62307.1|AA3_2	3.76e-131	20	615	20	608
CEF78598.1|AA3_2	8.33e-130	31	615	26	608

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	1.36e-110	39	615	5	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	6.36e-89	5	614	3	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
4YNT_A	6.65e-65	40	615	6	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
4H7U_A	8.95e-64	27	614	25	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6XUT_A	2.61e-61	20	618	2	591	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	1.07e-96	17	616	16	615	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	3.56e-86	6	616	16	617	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	3.56e-86	6	616	16	617	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A2H3D1U1|ARMD5_ARMGA	5.29e-79	41	615	41	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|P0DO29|ERIK_HERER	1.17e-65	6	616	8	597	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001092	0.998901	CS pos: 16-17. Pr: 0.6844

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_211169-t33_1-p1.