CAZyme Information: ASPSYDRAFT_210481-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_210481-t33_1-p1
• CAZy Family: GH142
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518	KV878594|CGC6	56327.55	4.4873

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878594:863561-865313(-)

Full Sequence      

MVRPQVSTAFLTLPVAFGLAVRTAETIPLSIPTTAAPGHQTIDGNFLSYSIEFSYMLDYA
GNNSHPNEFSKQLLENLYNISGAYPIIRAGGTTSNRAVFLANQSEALIEEFSSSDSDQPS
SLSIGPAWMESFQQFPKGTEYIYGLNFYDGESGIEQTVSEATTAYKEIGSHIYAFEIGNE
VDGFQCSSRRGCNWTVASYAAQFKEYAAAIVGQSLGDAPRGGTEPLFQGCAFQAPRHIGF
NETPFWNVENALELGLDTTGMVKTVADHEYMGSACDGETDTTIEDDLLNHHHMASRMYYH
EYLGNYTVSKGMPYVLGETNSISCQGLANVSDVYAAALWSVDYTLYAASLNISRVYYHMG
TPYRYSPWQPVQSNETAAHVKPLYYGNMFTAAALSGGNKQVSVLLNETSLAAYAIYDTDS
ESRTSLKSVAMLNLGVWNSTQPAAERPYTAFRLPNSTFSGASVKRLTSPGVEIAGNITFA
GQYVDDNGSVVGKQEVERLRDGEVRVGAGEAVLVTLSP

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_210481-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	45	505	7.2e-78	0.9494505494505494

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	1.53e-18	412	513	1	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQW38601.1|GH79	3.33e-178	25	515	28	516
BAE62550.1|GH79	3.35e-177	25	514	29	501
CAK41913.1|GH79	7.93e-177	27	514	32	516
QMW44049.1|GH79	2.87e-173	25	514	29	511
QMW32021.1|GH79	2.87e-173	25	514	29	511

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DFQ_A	8.21e-29	74	516	47	459	Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum],7DFS_A Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QEQ6|GUS79_ASPNC	1.07e-61	46	481	53	495	Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g11890 PE=1 SV=1
sp|Q7SFB0|GUS79_NEUCR	7.77e-50	27	510	20	534	Beta-glucuronidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU00937 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.392834	0.607163	CS pos: 22-23. Pr: 0.5320

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_210481-t33_1-p1.