CAZyme Information: ASPSYDRAFT_210105-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_210105-t33_1-p1
• CAZy Family: GH13|GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
757	KV878594|CGC8	83576.20	6.1357

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878594:325110-327429(+)

Full Sequence      

MRSLNLLLWALSTGVFAAPAPWDLGKGFSLAVDDTANRVSITQNGRRIWETVPGQNFISA
SGGEDIVTAANGNFKIEEVDHHRCAGQEITNVSQPAWNGTVNGHAAVVQGQLTDCGDATV
PFSVAFWVPSQFPDRIAFNAQVNGGSSSDAATKLFLTYRSSPSEDFYGLGGQASFASLKN
QSVPIFSREQGVGRGDQPTTELNSEDGFFAGGDHFTTYSAIPQYISSHSRVFFLTEESTA
YTTFDFTEANAVTVRYDAPSVDGYLMQAESMLDGITMVTDYTGKMPELPQWVDGGAVVGI
QGGQDKVNKVVEQGLSQGCPIAGVWLQDWSGTHEQSVSYMSLNVSRLWWNWENDANLYPT
WNDFVQSLRDRHNIRTLSYINPFIANVSTKSDGYRSHLYLEATKGGYMIQNATTNGTSVI
SSGPGLDAGIIDLTNPAGRSWFRNMMLDQVWNANISGFMTDFGEYTPVYPDTRFADKSID
PFFYHNAYPREWAALHQWIGKSVPQFKDSILFHRSSSMSANRYQNLYWAGDQAINWGVND
GIKSSVTVMAHMGLSGYAHGHTEIGGYTTTWDSNGVVNRTAELLGRWGELAAVSSSVFRS
HEGNVPQVNAQSYTNSSTYAYFAYNARMFASLGKYRRAILDTESKKLGWPVLRMPVIYYP
NDPKAKAISYQSFFLGADLYVAPVLDPGRMSVEVYFPGQGQMYTHVWSGKVYRGGQTARV
AAPYGKPAVFVVARPQHDLLHDFMQFVKKENGTVVRV

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_210105-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	264	731	4.3e-69	0.9812646370023419

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236691	PRK10426	1.93e-164	152	731	70	617	alpha-glucosidase; Provisional
269880	GH31_glucosidase_YihQ	1.76e-149	283	626	1	325	alpha-glucosidase YihQ-like. YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride. Orthologs of YihQ that have not yet been functionally characterized are present in plants and fungi. YihQ has sequence similarity to other GH31 enzymes such as CtsZ, a 6-alpha-glucosyltransferase from Bacillus globisporus, and YicI, an alpha-xylosidase from Echerichia coli. These latter two belong to different GH31 subfamilies than YihQ. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation.
224418	YicI	3.14e-62	153	731	142	664	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	1.34e-42	279	731	16	436	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269878	GH31_NET37	2.96e-28	350	698	49	361	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS28035.1|GH31	0.0	1	757	1	758
CAP79722.1|GH31	0.0	1	755	1	756
QQK47473.1|GH31	0.0	1	757	1	758
QMW44330.1|GH31	0.0	22	757	26	770
QMW32300.1|GH31	0.0	8	757	13	770

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OHY_A	3.21e-87	27	751	9	667	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]
5AED_A	6.15e-87	153	730	116	661	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AED_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEG_A A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5AEG_B A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5OHT_A A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12],5OHT_B A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12]
5OHS_A	1.69e-86	27	751	9	667	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_E Chain E, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_F Chain F, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_G Chain G, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_H Chain H, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_A Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]
5AEE_A	3.23e-86	153	730	116	661	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEE_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12]
6PNR_A	7.18e-84	46	730	17	647	Chain A, Alpha-glucosidase [[Eubacterium] rectale],6PNR_C Chain C, Alpha-glucosidase [[Eubacterium] rectale]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32138|SQASE_ECOLI	2.64e-86	153	730	116	661	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3
sp|Q9F234|AGL2_BACTQ	1.68e-17	164	731	147	668	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
sp|B9F676|GLU2A_ORYSJ	2.05e-10	330	715	382	755	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
sp|Q69ZQ1|MYORG_MOUSE	5.42e-10	354	697	365	680	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
sp|Q8BVW0|GANC_MOUSE	7.98e-10	398	730	432	756	Neutral alpha-glucosidase C OS=Mus musculus OX=10090 GN=Ganc PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000251	0.999720	CS pos: 17-18. Pr: 0.9814

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_210105-t33_1-p1.