CAZyme Information: ASPSYDRAFT_208133-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_208133-t33_1-p1
• CAZy Family: GH13|GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	KV878592|CGC14	53054.94	6.4292

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878592:63690-65114(+)

Full Sequence      

MLNGHKHTESGHPIEAKRAKTTAGGGLVSTSLFDALYSESAVLKIWTVARKALGSVAPPV
LYPEYTGADGGYVYRHLEFWTSGFFPGSLYLLLERNINYPQLGIRQDKTASLHPLQLQHL
CQWWSASLHANAAKKDTHDIGFMIAPWATKAWTLHRDPQAYSSLVLAAHSLAGRYDPCVQ
SIRSWDVCHTKVYSFCDTSKDFLVIIDNMLNLNLLFWVARETGDHSLHDIAVAHARTTKK
HHIRADNSTAHVVNYDAETGQPRSKFTHQGYSDDSCWSRGQAWGILGFMETYEWTRDPEF
LDTAMGLADYFLSRLPEDRVPFWDFDAPVTNDCPRDTSAGMVACCGLVLLYKALKDTDPA
AAQSYLHSALAILEATVSGFMTPSPARFDVDTTAPRHPTFPEDEPHRQPGALSMVLNSPE
MKCPETILDGATVCNYEFASRRWADHGLVYADYYFLLLGNMLLELGLVTEHNRH

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_208133-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	77	382	1.9e-99	0.8571428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400034	Glyco_hydro_88	1.91e-09	209	383	132	295	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS19540.1|GH88	7.68e-305	9	470	58	520
UDD54722.1|GH88	3.86e-224	32	469	42	494
QMW38998.1|GH88	1.10e-223	32	469	42	494
QMW26918.1|GH88	1.10e-223	32	469	42	494
QRD81239.1|GH88	1.10e-223	32	469	42	494

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	2.07e-46	59	374	52	338	Crystal structure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	9.68e-46	80	359	68	326	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	9.89e-46	80	359	69	327	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3ANI_A	5.15e-45	80	359	69	327	Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]
3VXD_A	5.15e-45	80	359	69	327	Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_B Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_C Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_D Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KLZ3|PLH1_FORAG	1.14e-53	80	351	77	327	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
sp|Q9A0T3|UCDH_STRP1	1.79e-49	62	373	52	344	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
sp|Q8DR77|UCDH_STRR6	4.81e-46	80	380	67	345	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
sp|Q8E372|UCDH_STRA3	5.09e-45	80	359	69	327	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
sp|Q9RC92|UGL_BACGL	3.27e-42	62	380	24	321	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_208133-t33_1-p1.