CAZyme Information: ASPSYDRAFT_203740-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_203740-t33_1-p1
• CAZy Family: GH131
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
178	KV878587|CGC7	20363.93	4.6606

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878587:455103-455697(-)

Full Sequence      

MVERVIRAGQHDWIWYIDFDVLITNTSMSLTDVIHESLENAPIPDAVDFLVTDDCNGLND
GSFIVRSSSRSIKFLDAVRARHDTEKEQNAKSLGDQDAISIFLKGNSPLVQHAMRIPQWT
INAFPEEIGCYDTHKEKWARGMFVVHFAGAWAHVTEEDPTGYLMRKYESEILWEPLPQ

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_203740-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	12	154	6.3e-24	0.6707317073170732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	7.64e-20	13	151	79	233	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX95548.1|GT34	6.70e-63	1	173	100	271
QRC98182.1|GT34	1.04e-62	1	173	103	274
QDS75934.1|GT34	6.93e-59	1	173	126	297
CAE7000514.1|GT34	9.42e-53	1	173	107	274
UJO20818.1|GT34	3.08e-39	4	167	142	312

PDB Hits     

ASPSYDRAFT_203740-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09681|GMH2_SCHPO	2.25e-13	1	151	158	329	Probable alpha-1,2-galactosyltransferase gmh2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh2 PE=3 SV=1
sp|Q09679|GMH1_SCHPO	1.37e-12	1	172	143	329	Probable alpha-1,2-galactosyltransferase gmh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh1 PE=3 SV=1
sp|Q10359|GMH3_SCHPO	1.24e-11	1	151	146	315	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1
sp|O94622|YBKD_SCHPO	9.04e-11	1	155	166	338	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|P50108|MNN10_YEAST	5.73e-08	12	125	200	333	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000016

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_203740-t33_1-p1.