CAZyme Information: ASPSYDRAFT_194380-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_194380-t33_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527	KV878582|CGC34	58412.93	6.3700

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878582:5241932-5243515(-)

Full Sequence      

MAAFSPSQTPSTSSSPNDLSPTRKKRKAESITSLSDGPTDAEVTLETSLIANIAELFDEN
IIAKIFRTASSSLTDSSIFTKPDGVPLGYPETVPQTGPNAGRYEFRDPEFWTCGFFPGSL
YALLERTTKYPHRSLIESSLFRPKLHDVRSQLRVLSKRWSKSLHSMAFRTDTHDIGFIVM
PALKRDWEILGNEQSLRSIIQAARSLATRYVSTAGTIRSWDCLVKKEITVTDQTENVLVI
IDSLCNLDLLYYASAHSGDGNLADLATAHARTLLQTHLRLEQGISVPKFGYQGQIYSTCH
VANINPATGHLKWRWTAQGYDNNSTWSRGQAWAILGYAQVYTWTKETIFLDAACGCAEYF
LYRLATAPGCVEIDADESQDLFPKTRTTTTKGRHVPLWDFDAPVNPEEPLRDSSAGVIAA
NGMLIIFQSLLGLGQDALARRFLNAALEIVQDTIDLCLAEETARFVTDGKSITVGDSIPG
SIFESILKNGTANNNQHARRRYCNHGLVYGDYYLIEFGNRLLDLGLA

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_194380-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	106	517	3e-83	0.9756838905775076

CDD Domains     

ASPSYDRAFT_194380-t33_1-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS21762.1|GH88	0.0	1	527	1	529
EAA67047.1|GH88	9.57e-244	1	480	1	487
QKD60239.1|GH88	2.60e-207	13	526	19	536
CEI67992.1|GH88	6.19e-207	29	527	21	512
CCT75108.1|GH88	4.10e-205	53	527	66	532

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	2.51e-29	101	424	63	317	Crystal structure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
1VD5_A	3.37e-22	91	446	22	310	Crystal Structure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution [Bacillus sp. GL1],2D5J_A Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2D5J_B Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2FUZ_A UGL hexagonal crystal structure without glycine and DTT molecules [Bacillus sp. GL1]
2AHF_A	1.50e-21	91	446	22	310	Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHF_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_A Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1]
2ZZR_A	2.12e-19	103	364	60	282	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	2.14e-19	103	364	61	283	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KLZ3|PLH1_FORAG	2.47e-31	111	524	77	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
sp|Q9A0T3|UCDH_STRP1	2.48e-23	89	364	48	284	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
sp|Q8DR77|UCDH_STRR6	3.58e-22	103	423	59	313	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
sp|Q9RC92|UGL_BACGL	1.73e-21	91	446	22	310	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
sp|Q8E372|UCDH_STRA3	1.10e-18	103	364	61	283	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000004

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_194380-t33_1-p1.