CAZyme Information: ASPSYDRAFT_169807-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_169807-t33_1-p1
• CAZy Family: GH114
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
566		61747.01	6.6647

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878583:68709-70580(+)

Full Sequence      

MQNLYDFIVVGGGPAGCTLATSLAKTAAKPQVLLLEAGGSNGAKNLRIDGKRWCTFIDEA
PSMNWGLKTAPLAQCNGRQIDYSTGKGLGGGSAINFGVYAVGARDDYEAWAEIVENPSFG
WGKMQDRIKRLESFSGLKNANNKKQHGRPATENHGFTGPLKVGYAKEWDRDLLPLLDSFA
EAGLERNFDHNSGNPIGLGLTINSAGNGRRTTAADILAGAPDNLVVLTDSPVQRVLLEGK
KAAGVQTKENKYFARKEVILSTGALVTPKKLMHSGIGPATQLANFNIPVVHGLPAVGKGL
KDHPFAPMILARDPSTNDRNAFFQDKKAMADALKQWEQDGTGPWAHYGCQIGSGWFKSER
ITSSAEFKALPTATREFMTRETIPQYELITNFPVHLVLPELFQDYSYICLTMFLMNEQSS
GEAKLQSANPDDPLLVDPKFLEHPFDRRACIEIYRHILELTKHPAIAKDTTATILGAKSE
SDEDILEHWKNNLSSSWHMAGTVKMGKDDADAAVNSHFQVFGVENLRVADMSVVPLLTNN
HTQATAYLTGATCADILIGEYKLEQT

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_169807-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	558	4.4e-143	0.9911971830985915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	4.48e-81	1	560	4	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	7.45e-75	1	559	2	533	choline dehydrogenase; Validated
215420	PLN02785	2.18e-38	5	550	56	569	Protein HOTHEAD
398739	GMC_oxred_C	3.33e-37	418	553	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	4.14e-24	75	304	14	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS19530.1|AA3_2	0.0	1	563	4	566
CAK46531.1|AA3_2	3.52e-260	2	566	5	568
BCR99292.1|AA3_2	1.27e-255	2	564	5	566
BCS11595.1|AA3_2	1.27e-255	2	564	5	566
BCS25214.1|AA3_2	1.08e-246	2	564	5	570

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	8.29e-47	5	562	41	602	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	1.08e-44	5	557	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.10e-44	5	557	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	3.61e-40	1	563	2	588	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6YS1_AAA	1.92e-39	5	560	8	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00593|ALKJ_PSEOL	8.87e-59	4	564	1	534	Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans OX=301 GN=alkJ PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	1.09e-57	4	558	1	528	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q0CJ60|ATC_ASPTN	8.49e-54	5	560	46	596	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	1.50e-53	5	557	41	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A1CFL2|PATE_ASPCL	7.12e-53	2	547	48	614	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000013

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_169807-t33_1-p1.