CAZyme Information: ASPSYDRAFT_167594-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_167594-t33_1-p1
• CAZy Family: GH11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620	KV878582|CGC25	68486.89	4.9257

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878582:2462765-2464627(-)

Full Sequence      

MRLISTVIALAAISPGCLGLAINNHGADFVQRNEGYPIYKDPSYSVDDRVQDLLRRMSIE
EKAGQLFHARLSEGPLDDEGEGNSTETMIAKKHMTHFNLASDITNATATAEFVNKVQKRA
LRTRLGIPVTLSSDPRHSFTENVGTGFQAGVFSQWPESLGLAALRDPQLVREFAEIAREE
YLAVGLRAALHPQVDISTEPRWARISGTWGENSTLTSELITEYIKGFQANDGKLGHNSVK
TVTKHFPGGGPMENGEDSHFVYGKNQTYPGDNFDEHLVPFKAAIAAGATEMMPYYSRPIG
TNYDPIGFSFNREIVTDLLRGELGFDGIVVTDWGLVTDGYIGTQYMPARAWGVESLSELE
RTAKILNAGCDQFGGEERPELVVQLVREGIISEERIDVSVARLLKEKFILGLFDNPFVDP
AAANKIVGKEHFVQSGRDAQRRSYTLLTNKQSTLPLAKPSRSTKFYIEGFDRAFMAERNY
TVVSTPSEADYALLRYNAPYEPRNGSFEAGFHAGSLAFNATERARQARIFSAVPTIVDIA
LDRPAVIPEIVEQAQAVLANYGSDSEAFLDVVFGQSKPEGRIPFDLPRSMEEVEGQMEDV
PFDTLNPVFRYGHGLSYGSN

Enzyme Prediction     

EC	3.2.1.21:5	3.2.1.38:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	122	372	1.5e-55	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.43e-60	57	470	1	363	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.74e-49	58	404	1	314	Glycosyl hydrolase family 3 N terminal domain.
185053	PRK15098	2.57e-45	50	617	38	648	beta-glucosidase BglX.
178629	PLN03080	2.76e-12	124	458	78	417	Probable beta-xylosidase; Provisional
235417	PRK05337	2.47e-09	240	371	161	275	beta-hexosaminidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS20857.1|GH3	0.0	1	618	1	618
EAA64969.1|GH3|3.2.1.21	0.0	1	620	1	618
BAE59617.1|GH3	0.0	9	619	31	646
QRD86843.1|GH3	0.0	1	619	1	624
UDD62113.1|GH3	0.0	1	619	1	624

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M6G_A	3.93e-52	2	618	11	615	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
6JGG_A	6.65e-45	24	616	1	602	Crystal structure of barley exohydrolaseI W434F mutant in complex with methyl 2-thio-beta-sophoroside. [Hordeum vulgare subsp. vulgare],6JGK_A Crystal structure of barley exohydrolaseI W434F mutant in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare subsp. vulgare],6LBV_A Crystal structure of barley exohydrolaseI W434F mutant in complex with methyl 6-thio-beta-gentiobioside [Hordeum vulgare subsp. vulgare],6LC5_A Crystal structure of barley exohydrolaseI W434F in complex with 4'-nitrophenyl thiolaminaribioside [Hordeum vulgare subsp. vulgare]
6JGQ_A	1.70e-44	24	616	1	602	Crystal structure of barley exohydrolaseI W434Y mutant in complex with methyl 2-thio-beta-sophoroside. [Hordeum vulgare subsp. vulgare],6JGR_A Crystal structure of barley exohydrolaseI W434Y in complex with 4'-nitrophenyl thiolaminaribioside [Hordeum vulgare subsp. vulgare],6JGS_A Crystal structure of barley exohydrolaseI W434Y mutant in complex with 4I,4III,4V-S-trithiocellohexaose. [Hordeum vulgare subsp. vulgare],6JGT_A Crystal structure of barley exohydrolaseI W434Y mutant in complex with methyl 6-thio-beta-gentiobioside. [Hordeum vulgare subsp. vulgare]
3WLI_A	3.16e-44	24	616	1	602	Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],3WLO_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],6JG1_A Chain A, Barley exohydrolase I [Hordeum vulgare subsp. vulgare],6JG2_A Chain A, Barley exohydrolase I [Hordeum vulgare subsp. vulgare],6MD6_A CRYSTAL STRUCTURE ANALYSIS OF PLANT EXOHYDROLASE IN COMPLEX WITH METHYL 2-THIO-BETA-SOPHOROSIDE [Hordeum vulgare subsp. vulgare]
6JGL_A	5.89e-44	24	616	1	602	Crystal structure of barley exohydrolaseI W434H mutant in complex with methyl 2-thio-beta-sophoroside [Hordeum vulgare subsp. vulgare],6JGN_A Crystal structure of barley exohydrolaseI W434H in complex with 4'-nitrophenyl thiolaminaribioside [Hordeum vulgare subsp. vulgare],6JGO_A Crystal structure of barley exohydrolaseI W434H mutant in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare subsp. vulgare],6JGP_A Crystal structure of barley exohydrolaseI W434H mutant in complex with methyl 6-thio-beta-gentiobioside. [Hordeum vulgare subsp. vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NGU6|BGLC_ASPFN	0.0	1	619	1	624	Probable beta-glucosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglC PE=3 SV=1
sp|Q5BCC6|BGLC_EMENI	0.0	1	620	1	618	Beta-glucosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglC PE=1 SV=1
sp|Q2UFP8|BGLC_ASPOR	0.0	9	619	13	628	Probable beta-glucosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglC PE=3 SV=2
sp|Q46684|BGLX_DICCH	7.85e-140	39	617	58	654	Periplasmic beta-glucosidase/beta-xylosidase OS=Dickeya chrysanthemi OX=556 GN=bgxA PE=3 SV=1
sp|T2KMH9|PLH34_FORAG	9.77e-42	39	619	29	640	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000781	0.999175	CS pos: 19-20. Pr: 0.9559

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_167594-t33_1-p1.