CAZyme Information: ASPSYDRAFT_165224-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_165224-t33_1-p1
• CAZy Family: GH106
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420	KV878605|CGC2	47810.06	6.0008

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878605:123504-124766(-)

Full Sequence      

MGSFILSRRARQLLAGLFTTLVLLSVSFIDNLSGFRPGLIITAATATAQCREGLCTVFPP
KIWQLWKTDPFSFEERELKVARSWTAKNPRYRYEVLTDNHDLEYVNTHFGPAGYNRPDIV
EVYNALQAKIIKADLLRYLVMYVEGGVYADIDVEDLRPVDRFIPDRYNEHDVDMVIGVEI
DEPDFREHPILGQKSMSFCQWTFMCKPQLPVMLRLTDNIITWLHGLSKKQGKPISELEMD
FDDVITGTGPSAFTNAVLAEMSIAAGHQITWDTFHDITESKLVGGFLVLTVEAFAAGQGH
SDSGNHDARSALVRHHYHASGWPNKHPRYKHPIYGEVEKCNWNKQCVREWDENTATFAAL
STEEQEKQIALKKGADEEAERQRQAEEAREKEAKERETKEKEAAEAAANPKRRNLHPTSF

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_165224-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	76	164	3e-19	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.75e-21	56	223	80	247	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.54e-12	75	165	2	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW40889.1|GT32	4.91e-192	1	379	1	372
BAE58544.1|GT32	4.91e-192	1	379	1	372
UDD56882.1|GT32	4.91e-192	1	379	1	372
QMW28814.1|GT32	5.70e-191	1	379	1	372
QRD83354.1|GT32	6.58e-191	1	379	5	376

PDB Hits     

ASPSYDRAFT_165224-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	2.84e-33	60	322	143	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	6.32e-30	58	294	130	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	5.26e-26	58	295	99	349	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	3.44e-20	59	237	97	300	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.49e-06	59	163	58	153	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000007	0.000004

TMHMM  Annotations     

Start	End
13	35