CAZyme Information: ASPSYDRAFT_160499-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_160499-t33_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
319		36357.07	7.0549

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878594:153202-154261(+)

Full Sequence      

MLLLLTDLIVVGLLLQTLNPLIILLYRNKQLFNPHVVLSSHNTSDIWHQTNQSNNIPRIL
HQTTATDVIPDDWIQSQRSCKDAYSEFEYMLWTDDSARDFLSIEYPWFLGTWDNYAFPIQ
RADAIRYFVLYHYGGLYLDMDTWCNQTIPVHAVESDPVTHRALFQSTLPTGITNSFMMAT
AKHPVYAAAITKLPASHAMTQFWARLQPYCAIMVSAGPMFLTLVVKDYLLKQPSLSSPTV
GVINATELAPYTTNIESGTWHRADARVFMWIADKPWIWFSAGTIVLVSGLCTLDYLLMII
SRRQPWKVATHGLKLAKVT

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_160499-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	73	148	2.3e-20	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.14e-35	56	279	82	298	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.63e-21	70	150	1	85	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ96119.1|GT32	6.42e-131	2	299	42	341
QYS99794.1|GT32	1.08e-126	2	309	47	363
UKZ78464.1|GT32	4.10e-126	3	318	47	369
UKZ69326.1|GT32	7.80e-126	2	318	37	357
QKD62321.1|GT32	1.83e-114	3	297	53	346

PDB Hits     

ASPSYDRAFT_160499-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	7.27e-45	50	224	51	214	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	2.03e-42	56	267	55	258	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	9.59e-42	56	266	62	265	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.01e-40	56	291	82	305	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	1.37e-36	38	271	46	272	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.993193	0.006838

TMHMM  Annotations     

Start	End
4	26
202	224
277	299