CAZyme Information: ASPSYDRAFT_159993-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_159993-t33_1-p1
• CAZy Family: CE3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
591	KV878594|CGC6	65333.16	6.0750

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878594:217695-219686(-)

Full Sequence      

MGSLADPDTTYDYIVCGGGTSGCVVAGRLAENKNVSVLLLEAGQHNRDLENVHMAGGWSQ
NFDSETDWNLITKPMDGVDNRQVKLSRGRFLGGCSGCNGTLCIRGSKQDYDDWQLEGWSG
DEFFEAMKKSETFHTKPWFKEDKSAHGYSGPLHTEPHDLAPIADRIIDSFVDQGLPLHHD
MFSTGDVPHGCGHVPRTVYKGVRTTSADFITKEYDRSNIAIKTDVTVDHVVLEPTADGQR
ATGVVTRSSDGTSKTFHARRETIISSGAYCSPAILLRSGIGARDELAKFDINCQVELPGV
GKNLMDHLIVFMFYEASQAGLTNCDKVYHGDSFAKTYQEYKEHKSGFLSTFPFGCFAFAR
IDHRLKDEPMWRDAPREPGRDPMGLTPKQPNIEFFTTETYGGPKQYDQFPVNNQHAFSII
SELFAPKSRGTVTLESKDPSRNPVIDCNYLNDPMDLLVLTEACQYANEIVMQGAGTKEIV
KGSWPPESGHHAFKTRDEWIPYVKHHATTCYHGAGTCAMGKADDPKAVLDNKLRVRGVAG
LRVADTSVMPTLHGGHTQMPAYGIGERCADFIKETWGPDSRSGVYYTDELG

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_159993-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	10	574	9.9e-160	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.34e-99	5	574	2	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	4.33e-90	8	573	3	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.91e-40	426	568	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.25e-30	78	309	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	3.27e-26	3	548	48	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS27972.1|AA3_2	0.0	1	579	1	579
AFB81353.1|AA3_2	0.0	1	576	1	576
EAA66972.1|AA3_2	0.0	1	576	1	584
QMW48130.1|AA3_2	0.0	1	580	1	578
QMW36070.1|AA3_2	0.0	1	580	1	578

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	5.64e-68	11	573	7	570	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	7.86e-68	11	573	7	570	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	1.10e-67	11	573	7	570	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3LJP_A	2.27e-59	8	573	11	527	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
3NNE_A	3.16e-59	8	573	11	527	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	4.23e-73	10	572	6	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q47944|SDH_GLUOY	7.24e-69	11	573	5	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|P9WMV5|Y1279_MYCTU	2.79e-65	8	573	2	527	Uncharacterized GMC-type oxidoreductase Rv1279 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1279 PE=1 SV=1
sp|P64264|Y1310_MYCBO	2.79e-65	8	573	2	527	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1
sp|P9WMV4|Y1279_MYCTO	2.79e-65	8	573	2	527	Uncharacterized GMC-type oxidoreductase MT1316 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1316 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000003

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_159993-t33_1-p1.