CAZyme Information: ASPSYDRAFT_158919-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_158919-t33_1-p1
• CAZy Family: CE2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
722		79046.84	5.1637

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878593:728247-730415(+)

Full Sequence      

MSPEYTFTDALAAVKSGSSLKETTNTLLTHLTKEERLSLLDGDTPFWAGQRSILLNRYNP
TPYNHGSTPRLSIPGIKFTDGPRGIVMGHSTAFPVSMARGATFDLALEEKVGNAIGLEAK
AQGANFYAGICVNLPRHPAWGRIQETYGEDPVLLGGFGVALARGVRGHVMACVKHFALNS
MENARFRVDVVVEEDVLREVYLEHFRRVVQEGGVAGVMSAYNSVNGEWAGQNGHLLIEIL
REEWGFDGLVMSDFVFGLRDAALSLRHGLDIEAPFIQQRGMHLGEALESGQVSWGDVDRA
CERILRKQLEIAIRTQKSQPGLDVVFCEEHRALAREVAARSMVLLKNDPLNGKPMLPLQA
DSLKRVAVVGRFANIANTGDKGSSQVYPPSVVTPLEGIRAALPDVEVLSADTREKAEKLA
SQVDTVICVVGYTYEDEGEYITPPLEDNPALRNCLPPTKSAEERETLAMFEGKIDSGGDM
QPGIGGDRTSLRLREEDEKLIAAVAAQNSNTVVSIVTAGAVIMETWKGRVPAILMSWYSG
SEGGHGLADVLLGKVDASGRLPFSIPTDEAHLPFFDRDATEIEYTRWFGQHLLDKLGVEA
AFPFGFGLSYTTWEVEDATAVKLDKDNIQVEFTVRNTGKRAGRFIAQVYGLPGVKDFPTR
VLLGFTPVDLEAGYEKKVQVSGSLRPVQKWDNGNFILRTEQLKIEVAKFAGDRKCAETEI
SL

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_158919-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	67	272	1.1e-55	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.79e-68	70	679	101	722	beta-glucosidase BglX.
224389	BglX	8.16e-56	69	401	56	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.99e-51	64	681	72	741	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	8.71e-51	342	610	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.21e-35	70	306	63	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS28742.1|GH3	0.0	1	722	1	723
AGC95327.1|GH3	0.0	5	722	7	725
UCK59088.1|GH3	0.0	4	721	6	724
BAE55411.1|GH3	0.0	4	721	6	724
QRD87369.1|GH3	0.0	4	721	6	724

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	3.44e-82	70	678	34	623	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	9.04e-79	22	706	2	698	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.25e-77	22	706	2	698	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
4I3G_A	8.97e-71	27	699	57	813	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
5WAB_A	1.49e-66	73	690	37	630	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P14002|BGLB_ACET2	1.77e-81	70	678	34	623	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
sp|P27034|BGLS_RHIRD	1.40e-76	27	649	5	734	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A7LXS8|BGH3A_BACO1	9.12e-71	58	692	63	714	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
sp|Q5BFG8|BGLB_EMENI	1.94e-68	27	712	14	829	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|F6C6C1|APY_BIFBA	1.30e-67	73	718	37	667	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_158919-t33_1-p1.