CAZyme Information: ASPSYDRAFT_157749-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_157749-t33_1-p1
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
644	KV878592|CGC11	71470.21	5.1357

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878592:501741-503770(+)

Full Sequence      

MPQTYPRPDFLRKDLTWTSLNGHWSFAFDDTNTGLSQNWQSTGLPPAQTTQITVPYAFQT
PASGINLQEAHEVIWYERRIKDIRTERDRAAGKKNRLLLRFGAVDYECEVWIDGVSVRRH
RGGYVPFDVDITDSFTSAPGGEARVTLRVRDSPTDLTQPRGKQYWGPVPESIFYTPTSGI
WQNVWLEVVPSVRIRDSSGGTVLRSDDIENGVLKGVIAVSQSNTGGCTVNVTTALAGAVV
GKTKIDIPVNQVSGAFEVDMRVPEGAVPKEGIFAGEGVWHNGVALWAPDHPILYDVVLQL
AGPDGNVLDEVQTTAGMRSVTWENSDGTFRLNGKPLFQMLCLDQGYWPETGLTPPSAEAL
KEDIVLAKKMGLNGCRKHQKVEDPAFLYYADRLGYLVWGEIANAYEFSADYIDRFNDEWT
QVVQRDRNHPCVVVWTPVNESWAYKNLKDNAQERSHIRSLYQTTKSLDPSRPINDNCGWE
HVQTDLTTYHDYSDSAELANICSKMEGGILARKLNGEMFLDPITQDSNVIDPGSKHKPGA
PVICSEMGGVNIAPAKGAQASSRDWGYTTAADPNDLLARLEKLFMAVVKGGHSCGFVYTQ
LSDIEQEVNGLYSYDRREKVPAARVKALMDAAAEYYYKNVAPAS

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_157749-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	16	498	7e-102	0.5106382978723404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	4.29e-47	1	474	1	430	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	2.91e-39	19	473	14	445	beta-D-glucuronidase; Provisional
236548	lacZ	7.70e-21	178	473	207	485	beta-galactosidase.
236673	ebgA	7.92e-21	20	471	44	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
397120	Glyco_hydro_2_N	2.18e-14	19	190	3	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS30572.1|GH2	0.0	1	644	1	641
AFD22629.1|GH2	0.0	1	642	1	643
EAA62925.1|GH2	0.0	1	642	1	643
QRD91609.1|GH2	8.50e-310	5	642	4	648
QMW47280.1|GH2	8.50e-310	5	642	4	648

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	8.13e-63	5	617	29	566	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
1BHG_A	3.97e-24	20	473	21	459	Human Beta-Glucuronidase At 2.6 A Resolution [Homo sapiens],1BHG_B Human Beta-Glucuronidase At 2.6 A Resolution [Homo sapiens],3HN3_A Human beta-glucuronidase at 1.7 A resolution [Homo sapiens],3HN3_B Human beta-glucuronidase at 1.7 A resolution [Homo sapiens],3HN3_D Human beta-glucuronidase at 1.7 A resolution [Homo sapiens],3HN3_E Human beta-glucuronidase at 1.7 A resolution [Homo sapiens]
5T98_A	1.37e-22	6	481	16	453	Crystal structure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4JKM_A	3.58e-22	20	473	18	444	Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],4JKM_B Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],6CXS_A Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13],6CXS_B Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13]
6ECA_A	8.19e-20	5	469	31	463	Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus],6ECA_B Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P77989|BGAL_THEP3	3.36e-27	9	492	4	433	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
sp|O18835|BGLR_CANLF	7.88e-26	5	492	29	510	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1
sp|O97524|BGLR_FELCA	1.36e-24	5	492	29	510	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1
sp|P08236|BGLR_HUMAN	2.32e-23	20	473	41	479	Beta-glucuronidase OS=Homo sapiens OX=9606 GN=GUSB PE=1 SV=2
sp|P06760|BGLR_RAT	7.13e-23	20	492	41	507	Beta-glucuronidase OS=Rattus norvegicus OX=10116 GN=Gusb PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_157749-t33_1-p1.