CAZyme Information: ASPSYDRAFT_156900-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_156900-t33_1-p1
• CAZy Family: CBM87|CE18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
621	KV878590|CGC5	67829.09	4.3819

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878590:972155-974365(-)

Full Sequence      

MARQSALLLFGGLLLCEALTVPRHATLVSTRDVESREYDFIIAGGGVAGLTVADRLTEVP
DVSVLVIESGAVDHGEDFVYIPGAYDYVPYSWHGLTNEPSKELNNRVFDSIVARVAGGGS
VVNAMIFLRGTSLDFDGWESLGNDGWGWEGMLPYFIKSENFTAPTPELAREGNLTWDDSV
RGHDGPVQYTYPNYIYPGLGAIYDAALHIGVQPRLDPNAGENTGVFNQPFAIDAATWTRS
SAKRNHYDPAVNRPNYHFLSNTTVARVLFDGTQAVGVEYLPSAGGQISRAYASREVLIAA
GALHTPQVLQLSGVGPRRMLESLDIPVVSDLPGVGSNLQDQTTFPFVYSWANSLTPNVTT
FLTNTTFAEEQRALYDECLPSAWAVTRGIAPKFVFMSYEDATIDTEYERILADAEARDPA
ESLPSDVDPTVLAGYAAQRQLMFDEFRDPGLSVGGSSWTTDANAQVFNVKPFSRGQVYIN
QTDPLANPVIDLRTASDPADFQLHIALFHKHRELFNAPSLAALGPTELVPGPDVQTDEQV
IETMREILEPSNAHQCCSAPMMPRELGGVLSPEMKVYGTTRLRVIDISHWPKELAGPPMA
SIYAAGEKVSDIIKAEYGWLE

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_156900-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	37	615	5e-159	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.64e-88	35	614	3	532	choline dehydrogenase; Validated
225186	BetA	2.24e-83	35	616	5	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.61e-33	471	608	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.03e-31	104	343	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.27e-16	38	340	56	326	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS25132.1|AA3_2	0.0	1	621	1	621
EAA58801.1|AA3_2	0.0	1	620	1	620
AEO67797.1|AA3_2	5.74e-222	17	617	25	636
CDP29496.1|AA3_2	1.76e-203	21	618	30	642
VBB81292.1|AA3_2	1.76e-203	21	618	30	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	6.79e-220	38	617	6	586	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	4.19e-102	15	617	14	642	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
4YNT_A	4.88e-69	38	616	6	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6XUT_A	2.05e-67	33	615	12	589	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
5NIT_A	3.19e-52	27	621	7	581	Glucose oxidase mutant A2 [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	0.0	1	620	1	620	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	4.93e-71	28	616	30	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.29e-69	32	613	41	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	1.29e-69	32	613	41	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	5.92e-66	3	614	2	608	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000652	0.999313	CS pos: 18-19. Pr: 0.9650

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_156900-t33_1-p1.