CAZyme Information: ASPSYDRAFT_153804-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_153804-t33_1-p1
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
462		49288.35	3.9044

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878588:858903-860412(-)

Full Sequence      

MIPLRRLLLALAVPKAVLSASSIEVDISSPLQEIHGFGFSQAFGRASEFEAASTDLQQQA
LDLLFSTETGAGFSIIRNNIPSSVDSTIEPESPGSPAATPNYTWSGDDAGQVWFTKQAVS
YGVSTIYANAWSAPGFMKTSGDEAAPGYLCGTTGHNCTSGDWKQAYANYLVQYVKYYETE
GLSITHLGFLNEPDYETSYSQMQISPDAAEAISFIPTLYQTVQDAHLDLNITCCDAIGWD
GQETYTTALNAAGMDEYLSVITSHMYTSDATSAIDTNLPTWITEAGVETSDAPFTTTWHD
SGAPNEGMVWASKLATGFIDANLSAYLFWEGFEIEETQSASHLVDVTGSSSGDVAEGSGI
FYAFAMWSRFIRPGAHRVQTSGSIDDVATAAFVNTDGSVVVVLTNSGDVTQTAQIGVSVE
FTVARAWVTDNDHQMAEMNVTVSGGSVGVDVPAQGVVTVKLT

Enzyme Prediction     

EC	3.2.1.8:3	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	21	459	7.6e-173	0.9909706546275395

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227807	XynC	1.73e-22	17	458	29	425	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
405300	Glyco_hydr_30_2	4.39e-09	20	240	1	232	O-Glycosyl hydrolase family 30.
307945	Glyco_hydro_30	1.51e-07	34	193	1	158	Glycosyl hydrolase family 30 TIM-barrel domain.
407314	Glyco_hydro_30C	1.81e-06	374	429	1	62	Glycosyl hydrolase family 30 beta sandwich domain.
396577	Glyco_hydro_59	9.29e-06	59	329	26	251	Glycosyl hydrolase family 59.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23084.1|GH30_7	3.20e-252	1	462	8	417
UKZ54336.1|GH30_7	8.85e-214	8	462	11	460
UKZ80109.1|GH30_7	8.85e-214	8	462	11	460
QYT05008.1|GH30_7	4.99e-211	19	460	20	458
UKZ91355.1|GH30_7	7.45e-189	21	462	25	463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M5Z_A	3.56e-130	9	462	11	454	Chain A, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7O0E_A	9.76e-110	19	461	1	447	Chain A, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	1.94e-108	19	461	8	454	Chain AAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6IUJ_A	3.02e-102	21	454	22	464	Chain A, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	3.28e-101	23	454	95	535	Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2Q1N4|XY30A_MYCTT	1.36e-109	19	461	25	471	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
sp|O16580|GLCM1_CAEEL	1.75e-10	25	412	89	488	Putative glucosylceramidase 1 OS=Caenorhabditis elegans OX=6239 GN=gba-1 PE=1 SV=2
sp|O16581|GLCM2_CAEEL	8.42e-08	18	405	82	479	Putative glucosylceramidase 2 OS=Caenorhabditis elegans OX=6239 GN=gba-2 PE=3 SV=2
sp|Q9UB00|GLCM4_CAEEL	7.95e-07	21	409	86	487	Putative glucosylceramidase 4 OS=Caenorhabditis elegans OX=6239 GN=gba-4 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.012618	0.987351	CS pos: 19-20. Pr: 0.9470

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_153804-t33_1-p1.