CAZyme Information: ASPSYDRAFT_153387-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_153387-t33_1-p1
• CAZy Family: CBM48
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1053	KV878587|CGC1	117782.49	4.9401

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878587:1524398-1527676(-)

Full Sequence      

MSSQAKQLALQADPERPDFMNPAVFRRNTLPARSYHIPSTSLLLNGAWEFNMSRSPPEAP
EPGEIISDEAWSSINVPGHWQLQGWGKPNYTNTQFPIPVCPPFVPTENPTGTYRRKFQVP
SEWKTNNTEIRLRFDGVDSAYHIWVNKALVGYAQGSRNASEFDVTSFLQDGDNEVFVRVY
QWSDATYIEDQDQWWLSGIFRDVTLIAFPANDRLNDWFIRTELDSEYKNATLLATIDYQV
TEQSAVVLNLIDPVQGSRSVIASTECIVEPATSTVELSLPVANPKKWSAEQPYLYEVEML
LTPRGSNKPPTITQRIGFRKVERKGGLITVNGKAIQLRGVNRHDHHPLLGRAVPLDFMRK
DLLLMKAHNVNALRCSHYPPDPRLLDMADELGLWVMDEADLECHGFYDAVSRPMDIDESL
GYEERKGLTFPQCGAHTSDNPVWRAAYVDRVQSMIQRDKNHASVIIWSMGNESFFGTCHR
SMVEYARAFDSTRLIHYEGDMPAETTDMFSYMYPEIDRLRSLAANEGVSSNGEFEKPIIL
CEYGHAMGNGPGLLTEYEKCFDEIPRLQGGFIWEWANHGLYLEGNSKKDGFYAYGGDFGD
YPNDGTFVMDGLLNSAHQPLPGLLQLKRVYEPVKLEVCGQRLALKNRYNFLDLNHLQASY
KLEAFDRETKTLATGSLDLPIVPAGQSAEISLPEELFLHNVHPAYLTITVEQRGKVEWDE
RTYAVSWTQALVSQPTETGLVNGMSSAQSALSTNSTKTTISVSGANWSFEFDRIRGHLRK
WTYNSRSILEPSPDTGLAIVPGFWRPPTDNDVPQAAPYWKRFGVNCLTNQFRSLNVSSLE
DGSVCIESETFISPPVLSWGWKCLARYTIKPNGSLSITMNLQPTGAAPTTVPRVGLNLRA
NSDLQAARWLGLGPGESYPDKKIAQKFGLWNVDDIASLQTVYDIPQENGNRMDTAWVEIL
TPNGTGFRASPQKSTVVNGGTGSLSWTASQYSDEIIEAARHTCDLVKDDAVFVRLDDQIA
GVGSAACGPGVMDEHLVKVQDTNFGMVLEPVSP

Enzyme Prediction     

EC	3.2.1.23:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	39	927	3.1e-213	0.9627659574468085

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236548	lacZ	0.0	8	1023	6	998	beta-galactosidase.
236673	ebgA	0.0	21	1052	6	1001	cryptic beta-D-galactosidase subunit alpha; Reviewed
225789	LacZ	1.14e-153	44	928	15	807	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
397119	Glyco_hydro_2_C	4.72e-113	321	634	1	301	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
214988	Bgal_small_N	4.37e-80	763	1048	1	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP98742.1|GH2	0.0	2	1052	3	1052
QBZ58582.1|GH2	0.0	8	1052	6	1045
UPK99756.1|GH2	0.0	6	1051	10	1049
AEO53731.1|GH2	0.0	4	1052	2	1079
QPC59330.1|GH2	0.0	1	1051	5	1049

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OB8_A	2.25e-247	21	1044	18	1025	Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_B Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_C Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_D Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OBA_A Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_B Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_C Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_D Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis]
6ETZ_A	2.53e-172	27	1049	21	986	Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB [Arthrobacter sp. 32cB],6H1P_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB - data collected at room temperature [Arthrobacter sp. 32cB]
6SEB_A	4.47e-172	27	1049	42	1007	Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB in complex with IPTG [Arthrobacter sp. 32cB],6SEC_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cBon complex with ONPG [Arthrobacter sp. 32cB],6SED_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB in complex with galactose [Arthrobacter sp. 32cB]
1YQ2_A	9.13e-172	30	1050	21	1023	Chain A, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_B Chain B, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_C Chain C, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_D Chain D, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_E Chain E, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_F Chain F, beta-galactosidase [Arthrobacter sp. C2-2]
6ZJP_A	1.24e-171	27	1049	42	1007	Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant E517Q [Arthrobacter sp. 32cB]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P00723|BGAL_KLULA	9.31e-247	21	1044	11	1018	Beta-galactosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=LAC4 PE=1 SV=2
sp|P06864|BGA2_ECOLI	1.01e-200	32	1052	30	1001	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
sp|B4S2K9|BGAL_ALTMD	7.77e-175	18	1023	12	1011	Beta-galactosidase OS=Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype) OX=1774373 GN=lacZ PE=3 SV=1
sp|P81650|BGAL_PSEHA	4.98e-171	9	1048	3	1033	Beta-galactosidase OS=Pseudoalteromonas haloplanktis OX=228 GN=lacZ PE=1 SV=2
sp|Q56307|BGAL_THEMA	1.23e-169	35	1023	33	954	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000006

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_153387-t33_1-p1.