CAZyme Information: ASPSYDRAFT_153380-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_153380-t33_1-p1
• CAZy Family: CBM48
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
852		94134.35	4.9250

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878587:683686-686478(+)

Full Sequence      

MESQSVQTLLSKLTLEEKVSLLAAVDWWRTPVIKRDDVFVPHIKTTDGPNGARGESYVSG
IKAACFPCGSSLGASFDRDLLFRIGQEIAKETQSKAANVLLAPTLNVIRSPRGGRNYETY
SEDPVVLGVLSAAFINGCQSMGIAATPKHFVANETENNRTVLSAQIDEQTLREVYLLPFQ
LLMKRSKPWCLMTSYNRVNGTYVSDDNRLVNGIARQEWGFDGVVVSDWMGVYSTADCINA
GVDLEMPGPTKWRGDKLLKVIEDGLVSEDTIDASATRVLELAKHLGRFENPEEPPELALQ
NPERDRFIATAGAEGMVLLKNDNDVLPLPNCATVAVIGHHALNAALGGGGSARVDSLRAI
SPVQGLKDAGFKVIEAPGVPVFGALPHADETIIYEPSTKAQTAEPVTLEWFNGNVIGQNL
AHEETKALPEYMIKEKWPSYLSAEYCSRMTFDIRPSTSGEHILSVISTGPAICYIDGERV
FTRFQETDLKPESFYFFKSQLERRFTYPMQAGQFYTLTLESWNTDPDILNGPRLKSRMFQ
GSALRFHEFINFPSRMENARSVASQASHAIVCIGTTTEIESEGFDRTSFALSQSQYDQIL
AVASANPNTIVANFSGSPVDLTPFVSKVPALIQAWFPGQEAGHSLALVLSGAVNPSGRLP
FSWPAQDEDNPTFGNFPCDQDNIVRYAEGLDVGYRYYDRQDTPTPLFPFGFGLGYGTDFR
VSNLRLLDPNSWSLGSDPEGLIRFTCSVKNHGIRSGATVLQYYISIPQPSTNGGRDRPLK
ELKEFQKLALKPGEEREITVSLDKYAVSYYNVQEKCWQVDAARYILSVGLSAEHIFQVME
FELGKGFQWTGL

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_153380-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	40	247	5.5e-61	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.00e-68	40	380	60	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.07e-60	66	843	120	764	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	5.29e-47	557	694	82	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.38e-42	66	281	88	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.24e-41	3	803	50	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS30061.1|GH3	0.0	141	852	1	712
UPK95967.1|GH3	0.0	1	852	1	851
QKD60297.1|GH3	0.0	3	852	4	834
CCT75026.1|GH3	0.0	7	852	5	831
CEI61625.1|GH3	0.0	2	852	3	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.67e-159	1	852	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	4.33e-156	6	852	6	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.15e-118	6	835	5	660	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.78e-93	3	838	2	658	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.46e-92	4	845	2	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	5.98e-177	6	843	11	838	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	4.46e-172	6	832	2	799	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	9.81e-170	6	852	6	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|A1DNN8|BGLJ_NEOFI	4.14e-169	1	852	9	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	1.68e-167	6	852	6	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_153380-t33_1-p1.