CAZyme Information: ASPSYDRAFT_152918-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_152918-t33_1-p1
• CAZy Family: CBM18|CBM18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320		34229.40	4.2856

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878587:922909-923987(+)

Full Sequence      

MSNLKFLLAVVSCLGPALAAPTPTTNFNKRADDTAFGFASLNGGTTGGAGGTTTTVSSYA
EFTAAVEGDEAKVVIVSGPISESASQVDVGSNTSILGADDSAVLDGFGLRLKEVENVIIR
NLGVKKVTAENGDAIGAEYSNNIWIDHVDVSSDMDHDKDYYDGLLDFKRGSDYITVSNSY
IHDHWKASLVGHSNSNEDEDKGKLHITYANNYWQNLNSRGPSIRFGTGHLYNNYYENVSD
GINTRIGAQVLVESNTWVDGKKALYSTDEGYAVERDNDFGGAKNEALEGTLTSVDYEYDL
LGPDAVKNAVVGTAGQTLTF

Enzyme Prediction     

EC	4.2.2.2:30

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	75	257	1.7e-85	0.994475138121547

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.51e-61	84	255	9	184	Amb_all domain.
226384	PelB	1.05e-54	4	315	6	340	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	3.87e-37	83	255	26	209	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS29964.1|PL1_7	1.54e-217	1	320	1	320
ABF50889.1|PL1_7|4.2.2.2	4.08e-194	1	320	1	327
CAW70629.1|PL1_7|4.2.2.2	4.08e-194	1	320	1	327
CAW61463.1|PL1_7|4.2.2.2	4.08e-194	1	320	1	327
EAA61832.1|PL1_7|4.2.2.2	4.08e-194	1	320	1	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	2.12e-44	37	315	6	321	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1PCL_A	8.13e-37	30	235	3	246	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
1OOC_A	1.89e-33	37	236	16	258	Chain A, Pectate lyase A [Dickeya chrysanthemi],1OOC_B Chain B, Pectate lyase A [Dickeya chrysanthemi],1PE9_A Chain A, Pectate lyase A [Dickeya chrysanthemi],1PE9_B Chain B, Pectate lyase A [Dickeya chrysanthemi]
1JRG_A	1.37e-32	37	236	16	258	Chain A, Pectate lyase [Dickeya chrysanthemi],1JRG_B Chain B, Pectate lyase [Dickeya chrysanthemi],1JTA_A Chain A, pectate lyase A [Dickeya chrysanthemi]
3ZSC_A	1.78e-27	32	251	3	226	Catalytic function and substrate recognition of the pectate lyase from Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AVN4|PLYA_EMENI	7.24e-195	1	320	1	327	Pectate lyase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyA PE=1 SV=1
sp|Q4WIT0|PLYA_ASPFU	4.03e-158	4	320	1	321	Probable pectate lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyA PE=3 SV=1
sp|B0XT32|PLYA_ASPFC	2.32e-157	4	320	1	321	Probable pectate lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyA PE=3 SV=1
sp|A2QV36|PLYA_ASPNC	4.11e-156	1	320	1	323	Probable pectate lyase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=plyA PE=3 SV=1
sp|Q9C2Z0|PLYA_ASPNG	5.83e-156	1	320	1	323	Pectate lyase A OS=Aspergillus niger OX=5061 GN=plyA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000243	0.999729	CS pos: 30-31. Pr: 0.8524

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_152918-t33_1-p1.