CAZyme Information: ASPSYDRAFT_150601-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_150601-t33_1-p1
• CAZy Family: AA8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272	KV878585|CGC20	29490.68	4.2941

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878585:1898061-1898879(-)

Full Sequence      

MVSFKYLATALMATAAIAAPHGHLHSHSRVTKRQSSSKRGAAYNDASTVQSLAGSGSVSW
AYDWNMYAMGDLPSNVEFVPMLWGTKMFTGWFAAIQTLLNSGSSHILGFNEPDMDSQAAM
SSSDAASYYREYISPLSGQAKLVSPAVTNGVGDDMGLDWMRNFLNLCTDCNINALAVHWY
GESADDFKSFVQQATDLANEFNLAETWVTEFALNSDMSGSGGSDQSTEFLSDVIPWLDQQ
DSVARYAYYMCADGYLLSGSDLSISGKAYTSS

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_150601-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	53	257	1.6e-65	0.8883928571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	1.08e-77	42	269	1	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23989.1|GH128	2.68e-185	1	272	1	272
EAA59234.1|GH128	6.71e-146	1	271	1	279
BAE57006.1|GH128	5.00e-126	1	270	1	272
QMW39356.1|GH128	5.00e-126	1	270	1	272
UDD55125.1|GH128	5.00e-126	1	270	1	272

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UAY_A	5.27e-55	23	269	20	258	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAY_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAZ_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UAZ_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UB1_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_C Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_D Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii]
6UB0_A	1.19e-54	36	269	2	227	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -2 and -1 subsites [Blastomyces gilchristii SLH14081]
6UAX_A	7.47e-20	38	249	95	316	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56],6UAX_B Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56]
6UB7_A	9.10e-16	58	249	56	249	Chain A, Glyco_hydro_cc domain-containing protein [Cryptococcus neoformans]
6UAQ_A	1.17e-14	38	269	25	259	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09788|ASL1_SCHPO	1.12e-21	58	271	318	530	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.005696	0.994283	CS pos: 18-19. Pr: 0.9517

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_150601-t33_1-p1.