CAZyme Information: ASPSYDRAFT_149732-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_149732-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
604	KV878585|CGC16	69715.26	5.6690

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878585:2329876-2331748(-)

Full Sequence      

MAARSYQRLGLLVATGFLVILSLVFLESRKPGTFGNQDIAPPEQASPPPSQIQQDVELPT
DPVSNSSSALHPIASFIDDAEKQLNQLLERQSKTLKDAVNEYRRRYNMNPPPHFDKWFQY
AQSKGVELIDEYDTIYHSLLPFWGLSPQTIRARAREALGGGNGLYGVLVRNGKISLLEGL
GEEDWRRPATQGMLKDFVKYLPDMDLAFNVHDEPRVIVPNDDLQRLVSIAKDHAIPRAFA
TQAAVNAWSARPRDINKGDRIEGVRTTRFNTISRQPAWIESRMSCPADSPVRSLDENSPD
DTTGYAHTEFGFIHNTTAFSDVCNTPSLRDTFAFFERPNTFDVVRDLFPIFSQSKVSTFQ
DILYPSPWYWDKRVEYVESQDFSWEEKIDKLYWRGSTTGGWSVNGGWRRQHRQVMVGNIN
SLGMVKVLAKNDNGQWESKEVNRRNYHDLFDVHFTFIQQCDEHDCAAQEEFFDLAPQEEQ
KGAWSYKYLVDVDGNAFSGRYHAFLESNSLVFKVSMFREWHDERLKPWLHYIPMSLKGNE
FVETMRYFISEEEGKVAGPRLAQKGKDWAQRTLRKQDMEVWLFRLLLEYGRLVDDNRENL
GFVE

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_149732-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	325	593	4.6e-79	0.984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	8.89e-19	349	592	32	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	6.48e-08	349	592	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23821.1|GT90	0.0	1	603	1	602
EAA58972.1|GT90	4.24e-305	1	588	1	585
BCR83603.1|GT90	8.90e-280	7	603	4	599
UCK57446.1|GT90	5.86e-278	7	602	14	617
BAE54850.1|GT90	1.16e-277	7	602	4	607

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	3.04e-08	349	596	118	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	1.10e-07	349	593	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.52e-58	26	599	108	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	4.71e-09	345	593	160	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	6.22e-09	349	593	163	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	1.78e-07	349	596	146	373	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	2.36e-07	349	596	146	373	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000001

TMHMM  Annotations     

Start	End
9	26