CAZyme Information: ASPSYDRAFT_149120-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_149120-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
552	KV878585|CGC11	59448.88	5.3503

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878585:1399079-1400737(+)

Full Sequence      

MASPEADYIIVGGGLTGCAVASRLKQRNPSLDIVVLEAGPDASDNPNVKTFPGLFSLLDS
ELDWAYATTPQANTENRKHTVHAGKALGGGSTINFGGWSRGDSTDYDLWATTVKDSRWSF
RGLLPYFRRSETFFDRSADPEYHGFEGPVRVTSVSASDPKRRYPLREPIMDAWVEIGEKH
NSDVGSGQLSGIVEFLETWDGGERQAAYQAYSLDGVQCITDAAVRKVEFENGPDTQRKAS
AVLLTDGRRFTARREIILAAGALRTPQLLMLSGIGPTDALTKYGIHTTVNAPHVGKNLID
HFALYQLYKLRNPERGLALGSPVLSDPAFVKGLPTDWAVNQQVPREILESAVQKDKQRFG
PDSDDSALIPGRPLVETLTVYAPAGIPNVPMDGSLIVTSVMLLAASSRGSVSICSADPAD
PPLVDSNYYDTETDRATLIHGARRTTRAMLDTDALKGYIECEVPPPGMSALSSRSSDAEF
DARIRATGMAHHHPAGTAAMGRVVDGELRVYGVQGLRVVDASVLPVSIGGHPQATLYAVA
EQAVDLILGIGY

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_149120-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	6	548	1.2e-143	0.9911971830985915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	5.58e-94	1	549	1	533	choline dehydrogenase; Validated
225186	BetA	1.63e-91	1	549	3	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.06e-39	407	543	3	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	4.02e-30	72	301	12	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.42e-27	7	536	57	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS24209.1|AA3_2	0.0	1	550	1	550
EAA61138.1|AA3_2	1.28e-300	1	548	1	542
QMW27401.1|AA3_2	8.52e-294	5	549	7	552
QMW39472.1|AA3_2	8.52e-294	5	549	7	552
QRD81789.1|AA3_2	8.52e-294	5	549	7	552

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	5.56e-67	7	547	7	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
3Q9T_A	4.95e-60	7	547	8	569	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
6XUT_A	6.45e-60	7	547	18	587	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
5ZU3_A	6.88e-60	7	547	8	569	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	9.55e-60	7	547	8	569	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	8.38e-118	3	548	2	519	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|Q988C9|4PADH_RHILO	1.04e-68	7	547	8	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|P9WMV4|Y1279_MYCTO	6.58e-62	5	547	4	526	Uncharacterized GMC-type oxidoreductase MT1316 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1316 PE=3 SV=1
sp|P64264|Y1310_MYCBO	6.58e-62	5	547	4	526	Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1310 PE=3 SV=1
sp|P9WMV5|Y1279_MYCTU	6.58e-62	5	547	4	526	Uncharacterized GMC-type oxidoreductase Rv1279 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1279 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000006

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_149120-t33_1-p1.