CAZyme Information: ASPSYDRAFT_147370-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_147370-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389	KV878584|CGC24	42270.07	4.9725

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878584:2313487-2314708(-)

Full Sequence      

MLRPYLWALLFLNTLLVCAASIPSNARQRCQRSLEACPKDTVVVSASNPKAQFSTVQSAI
ESLPNDNSSQTILVLAGEYIEQLNVTRPGPVTLLGQTDHITDASKNKVTITWAQANHDNT
GQSVDNVFSSVLVVAPTLDSSYTGSGPTGYPVPEDTPFGSVDFRVYNIDFVNTWSEFSDG
PAHALSFSRANGGFYYCGFYSYQDTVYVGKLANAYFYKSIIAGQTDFLYGFGTAWIQSSE
ILLRNCGGGITAWKGTNTTFENKYGVYIVESTVQAANASIAPDIVGSCPLGRPWNSLHRS
IFAHSYEDGSVASSGYIDWVVDGESRLTNGTLMAEYRVFGPGFNETGRASTNASIVLTSR
EYAPYDSPQKVFLTPSGKPGNVGWIDWHA

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_147370-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	43	364	8.2e-57	0.9618055555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178372	PLN02773	5.44e-23	38	376	2	294	pectinesterase
215367	PLN02682	5.57e-23	38	368	67	358	pectinesterase family protein
178051	PLN02432	3.07e-22	50	365	20	280	putative pectinesterase
178098	PLN02480	1.63e-20	1	367	1	329	Probable pectinesterase
215357	PLN02665	7.65e-19	35	367	64	350	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS22782.1|CE8	5.49e-280	1	389	1	389
EAA60938.1|CE8	6.53e-240	7	389	7	389
BAE63594.1|CE8	3.09e-203	16	386	13	382
UDD62592.1|CE8	3.09e-203	16	386	13	382
QRD94539.1|CE8	2.53e-202	16	386	13	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	1.31e-20	53	348	19	271	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	1.79e-20	53	348	19	271	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
3UW0_A	6.19e-08	43	322	34	297	Pectin methylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UBD9|PMEA_ASPOR	4.25e-21	38	368	23	305	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1
sp|B8NPS7|PMEA_ASPFN	4.25e-21	38	368	23	305	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	2.77e-20	52	348	43	296	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|A2QK82|PMEA_ASPNC	1.00e-19	53	348	47	299	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|Q9LVQ0|PME31_ARATH	1.43e-16	53	342	17	269	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000421	0.999541	CS pos: 21-22. Pr: 0.6410

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_147370-t33_1-p1.