CAZyme Information: ASPSYDRAFT_146977-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_146977-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
755	KV878584|CGC9	84697.45	6.5044

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878584:886352-888619(+)

Full Sequence      

MSELWYQRPAAGWDEALPVGNGRLGAMVYGRTDAELLQLNEDSVWYGGPQERIPGDALKY
LPHLRKLIRQGAHNEAEELVRRAFFASPNSQRHYEPLGTLYLEFGHPFDGVKRYRRSLDL
KAGISHVNYEYAGVQFHRQVLASHPDNVLAIRVQASKRVEFLVRLSRLSELEYETNEFLD
DITVDDQFITMHVTPGGKGSIRAACKLTIRCDSDSQDPARIERVGKNLVVNARAALILIA
AQSTYRCNDIDQAARTNLTSALAHATDTIWSRHVADYQALYGRLELLLGPDAADIPTDER
ILNKRDPGLIALYLHYSRYLLISCSRPGKADDSDHVLPATLQGIWNPSFHPPWGCRYTLN
INLQMNYWPANVGNLAECEQPLFALLERLAVTGAETARKMYGCRGWTVHHNTDLWADTAP
VDRWMPATLWPLGGAWLCTHIWEHYLFSGDKYFLRRMFLVLQGCVEFLLDYLVDDALGLY
KVTNPSLSPENTFRDGKGNAGILCEGSTIDIQLVRAVLEAFVAALKVLDITGNELLPKVR
DILRRLPPLRIGSAGQLQEWMIDYEELEPGHRHVSHLWALYPGRDINLDTTPELAKSCAV
TLKRRQSAGGGHTGWSRAWLLNLHARLRDADECANQIEQLLAKSTLPNLLDTHPPFQIDG
NFGGSAGILEMLVQSHEDGIIRLLPACPPAWRSGRLRGVRARGGFELEFGWEDGVIRGPV
IVKSELGLRAVVQYPNDGPRKVVEDTGVIILNDDN

Enzyme Prediction     

EC	3.2.1.-:3	3.2.1.63:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	3	735	1.9e-258	0.9778393351800554

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
405224	Glyco_hyd_65N_2	3.59e-65	4	214	1	202	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.
274350	PEP_TPR_lipo	0.004	40	174	549	700	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
380200	F430_CfbE	0.007	498	569	341	407	coenzyme F430 synthase. Members of this family are coenzyme F430 synthase, involving in synthesizing coenzyme F430, which is used in methanogens by coenzyme M reductase. Members of this family are restricted to archaeal methanogens, and resemble (and may be misannotated as) MurD, an enzyme of bacterial cell wall biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS22189.1|GH95	0.0	1	754	1	754
EAA63677.1|GH1|GH95	0.0	1	719	1	721
CAP91981.1|GH95	0.0	1	734	1	724
QQK46885.1|GH95	0.0	1	734	1	724
QGA20267.1|GH95	0.0	2	739	3	740

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UFC_A	2.03e-166	3	742	23	755	Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
7KMQ_A	2.31e-161	3	734	42	759	Chain A, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
2RDY_A	5.25e-147	3	725	4	746	Chain A, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
2EAB_A	2.25e-74	4	752	20	869	Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	8.06e-74	4	752	20	869	Chain A, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8L7W8|FUCO2_ARATH	1.60e-141	3	714	53	795	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
sp|A2R797|AFCA_ASPNC	6.33e-75	16	713	38	758	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
sp|Q5AU81|AFCA_EMENI	1.13e-68	19	738	46	803	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
sp|Q2USL3|AFCA_ASPOR	6.06e-55	2	736	16	716	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000006

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_146977-t33_1-p1.