CAZyme Information: ASPSYDRAFT_146464-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_146464-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
612	KV878584|CGC22	66651.76	4.9093

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878584:2893741-2895579(-)

Full Sequence      

MKLIHHFIVPLATLAQAYTAAEQVDVQSSLLSNPNDVADKTFDYIIAGGGLTGLTVAAKL
TENPNIDVLVIEKGFYESNAGPIIEDPNNYGQVFGSSGDQNYLSVQQINNRTAAIVSGKG
LGGSTLVNGNSWTRPDKAQIDSWEKIFGMQGWTWDSILPYMNKAERSRAPNTAEIAAGHS
FDASCHGFNGTVHAGPRDNGKPWSPVMKALMNTTSALGIPTQVDFHCGHPRGVSMIPNNL
LEDQTRADTAREWLLPSYTRPNLKILTGQVVGKVLFDKKNSASDPSSTSNQPRAVGVNFG
THRAVNFNTYAKREVLLAAGSAISPLILEYSGIGPRAVLDNANVTQIIDLPVGLNMQEQT
TTSVRARSAPEGFGQGQAAYFANFTEVFGDDSARAVELLNTKLDQWAEETVAQGGFHNVT
ALKMQYEEYRSWLLDEDVAYAELFLDTEGNIKFDIWDLIPFTRGSTHILSSDPYMWHYAN
DPKLYRNELDVLGQAAATRLARNLQSSGDMAKYFAGEITPGDQVPSDATLDQWAEYVTDV
FRPNYHAIGTCSMMARELGGVVDATAKVYGTQGLRVIDGSIPPTQLSSHVMTVFYGMALK
IAEAVLADYEKA

Enzyme Prediction     

EC	1.1.3.4:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	40	607	1.1e-141	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	6.10e-59	38	584	2	510	choline dehydrogenase; Validated
225186	BetA	4.23e-58	36	608	2	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	1.79e-43	43	587	2	468	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	3.46e-41	109	357	15	214	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	9.12e-25	460	601	1	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23023.1|AA3_2	0.0	1	612	1	608
AFA42947.1|AA3_2|1.1.3.4	0.0	16	612	17	603
QKX58713.1|AA3_2	0.0	16	611	17	603
ABM63225.1|AA3_2	0.0	12	612	13	604
UDD62262.1|AA3_2	1.33e-313	15	612	16	606

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GPE_A	0.0	18	612	1	586	Glucose Oxidase From Penicillium Amagasakiense [Penicillium amagasakiense],1GPE_B Glucose Oxidase From Penicillium Amagasakiense [Penicillium amagasakiense]
1CF3_A	1.58e-281	26	609	4	579	GLUCOSE OXIDASE FROM APERGILLUS NIGER [Aspergillus niger],1GAL_A CRYSTAL STRUCTURE OF GLUCOSE OXIDASE FROM ASPERGILLUS NIGER: REFINED AT 2.3 ANGSTROMS RESOLUTION [Aspergillus niger],3QVP_A Crystal structure of glucose oxidase for space group C2221 at 1.2 A resolution [Aspergillus niger],3QVR_A Crystal structure of glucose oxidase for space group P3121 at 1.3 A resolution. [Aspergillus niger]
5NIT_A	2.41e-280	26	609	2	577	Glucose oxidase mutant A2 [Aspergillus niger]
5NIW_A	3.42e-280	26	609	2	577	Glucose oxydase mutant A2 [Aspergillus niger]
4YNT_A	2.78e-100	41	612	5	571	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P81156|GOX_PENAG	0.0	18	612	1	586	Glucose oxidase OS=Penicillium amagasakiense OX=63559 PE=1 SV=1
sp|Q92452|GOX_TALFL	0.0	12	612	13	604	Glucose oxidase OS=Talaromyces flavus OX=5095 GN=GOX PE=3 SV=1
sp|P13006|GOX_ASPNG	1.81e-280	26	609	26	601	Glucose oxidase OS=Aspergillus niger OX=5061 GN=gox PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	7.78e-67	36	608	41	618	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	7.78e-67	36	608	41	618	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.586098	0.413927

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_146464-t33_1-p1.