CAZyme Information: ASPSYDRAFT_145302-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_145302-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
284	KV878583|CGC23	29443.03	4.1080

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878583:3128761-3129615(+)

Full Sequence      

MKQATSILAAAGLISLANAHGYITTPKPRLPGIAMSSACGEQIYNNQKADRAGNVQGELQ
IGAGQEDYNEEACHIWLCKGYQFEDNKDNVQQYSAGQTVDFVVDILAPHTGVANVSVVDT
SSNSVIGEPLKSWAKNYASTETGVSEDDTNFSVTIPENLDGKCSEAGACVLQWYWFAESI
DQTYESCVDFTVGGGGSGSGSGSGSSSSSSSSSSGSGASTTSAPAETQTAVNKVIDVPTT
LSTATRPAETATGTAQATAVPAEGSSDEQMNWLSSIFKAVTSRQ

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_145302-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA16	20	190	6e-73	0.9940119760479041

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	3.87e-07	20	190	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS18392.1|AA16	6.06e-160	1	284	1	283
EAA65420.1|AA16	1.54e-111	1	194	1	193
BCR86587.1|AA16	3.48e-109	1	280	1	265
QLE11222.1|AA16	1.30e-106	1	280	1	285
CAF32158.1|AA16	1.30e-106	1	280	1	285

PDB Hits     

ASPSYDRAFT_145302-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPSYDRAFT_145302-t33_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001069	0.998893	CS pos: 19-20. Pr: 0.9723

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_145302-t33_1-p1.