CAZyme Information: ASPSYDRAFT_143606-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_143606-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
885	KV878583|CGC4	94674.55	5.4650

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878583:2029212-2032136(-)

Full Sequence      

MEANPWKRMSCMLIGLLAAKAVYSAPTPTSSESTTFSEKTQYPPSIQGGRVLPPQTEGVY
HTELDRVGHILQKPTSIPYSTGRLQSIPGILGSVGEPYPLFGSLFPDQDSSEDSEPEPSS
SSVITTPSSTAAGNATHGVLEEPTAASEPSGEQGSSSQTSTLAIQGTMAASQDAFVPGAT
GAVPQAITSRGDHPVPKKGVNTSGPIETNKFHSALFLGTQTNATFTHPYTLAWSKGSGNL
SSFGMTVSHAEANVVANGPTNDKIPGNPISYYINPIGIQSIIFSATELTQSTVLTSENPS
PFAADAVLQPQRGSSSKITIPVVQGMAYVSAVYTQLQPVLQSGVHFREVVTAASPRNGIF
KYRATLEDGTAWLIYVNPSDGKDPGLKLVSTTDLRGPTGWSGTIQVAKNPAGSSGERLFD
NSSGVYATAAAVSGGVDGQTGTYRLSWTKAGKDAPSTPLMMYALPHHVAAFDSQTQGRAV
NITLRTTTKGTAKAVIGESWTMVEPDIPTSMGFGPWIAASGNSPQLSDAAKSVIREAATT
ELQQDIDGQSNLNSMYYSGKALSKFATIIYTVDKLVGDSATAAPALERLKQAFARFVQNK
QQFPLVYDTVWKGVVSSASYGGDVGADFGNTLYNDHHFHYGYFIHAAAIIGALDPSWIDA
NSDWVNMLVRDSGNAATNDPLFPFSRGFDWYHGHSWAKGLFESFDGKDQESSSEDAMYAY
ALKMWGKTSGDASMEARGNLMLGVLRRSLHNYFLMDSDNVNQPANFIANKVTGILFENKV
DHTTYFGANLEYIQGIHMLPLLPSSSYIRSQKFVREEWNAMFASNASTPAETVEGGWKGV
LYANLALIDPAASWNYFAQPNFDYGSIDGGASRTWYLAFAAGEFI

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	195	879	1.2e-228	0.9855305466237942

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	193	882	75	754	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	526	877	2	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	3.38e-148	193	516	1	319	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS18746.1|GH81	0.0	1	882	1	881
CBF89420.1|GH81|3.2.1.39	0.0	1	882	1	900
EAA66571.1|GH81	0.0	1	883	1	893
QRD82801.1|GH81	0.0	1	882	1	906
QMW28320.1|GH81	0.0	1	882	1	906

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.90e-100	173	881	7	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	3.34e-100	173	881	32	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	2.74e-97	173	881	7	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	6.99e-29	556	859	340	636	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5UPI_A	1.67e-20	556	873	361	674	Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPM_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPN_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125],5UPO_A Chain A, BH0236 protein [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	0.0	170	884	189	903	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	9.10e-178	173	882	2	701	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	3.11e-169	193	882	66	736	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	1.51e-158	184	882	411	1111	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	1.08e-152	184	882	437	1140	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000574	0.999390	CS pos: 24-25. Pr: 0.9728

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_143606-t33_1-p1.