CAZyme Information: ASPSYDRAFT_142918-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_142918-t33_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
985		110928.87	7.3473

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878583:1227294-1230598(-)

Full Sequence      

MIRLSVENGLRALLGAFLLSCTFLTTSYSTTFAFDHPLQTATLVCFLSGISLLILNRFVH
RIPAISRPDKYSTIPLTELDDSTVEVLSPVSNDDDSAKDKRTWKWWLGIGLVTGIGCARL
SLYRNITENVECAPPGYAYLIPLYIAVYDFCRNQRASKGRARPDHFPNTLLRIPLTIASR
VRFLVLQSRLRYVITAALLAASGLLVSSFDHGRESTFICPIISGEHARQRMLKIISLVLD
TLVLIGAAELSGEGACRDGRRKQTLLAWGCGLVGVAFFWGAWTIHSNRTAGPGTFVTSLY
LGSASSQVALITVIIVSASQLFPHYGAVGLCILAGFIVNYLELISAVFNGQESFPQIPAS
QALPALSFICLGGLIFLLSRIASDDEPLFLHRLNLVSRLVFFIMFGTGLFFISKRSNVVH
THPIESLIHEAGKKHDMWLKSAKGSSNLAEAVQQYRTKYNQYPPPGFDKWYDYAVSRSSV
TIDEFDDIYANLLPFRALEPGEIRTMTQKLATNPFNGIGALSIRNGTVRVQEGIRPTHAW
MVQSAGKIIEKFSEYLPDMDLAFNLDDEPRVIAPWEKVEDLRKRARMQQLPPDDNISNEW
SVERNATWGPIEPADQTPEAMFLDRSLHRAFDPYIAPACPPGSKARSRRIWDKRHLCMEC
IRPHSKGQFPTGWDIASDICHQPDLATLHGLLTSPASFKITQELVPVFSQSSTSGFNDII
FPSPWNYVDKITYTPSDEHPDHQYTDKKNTLFWIGSTSEGVSHEGRWKGMPRQRLAHVVN
NNTYNHVSVLLPADEPKTYAYQVFDGRAPTQVLGLNTSVSITDPVVRCQDKDCADQTDEL
HTGGRVDFQDHWQYRYLFDSDGAGFSGRFLPFLQSRSLPFKTGLFRQWFDSRITPWLHYV
PIDIRLHGLWSTMAYFAGVDATVDGQKIEMERHDTQGVLIAEEGRKWAEKALRKEDMEIY
FFRLLLEWGRLTDDRRDLLGFKLPP

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_142918-t33_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	683	972	7.7e-76	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.58e-14	704	971	30	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.31e-07	706	971	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
340912	MFS_Mch1p_like	0.009	272	412	71	216	Monocarboxylate transporter-homologous (Mch) 1 protein and similar transporters of the Major Facilitator Superfamily of transporters. Yeast monocarboxylate transporter-homologous (Mch) proteins are putative transporters that do not transport monocarboxylic acids across the plasma membrane, and may play roles distinct from their mammalian counterparts. Their function has not been determined. The Mch1p-like group belongs to the Monocarboxylate transporter -like (MCT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS19053.1|GT90	0.0	1	984	1	963
EAA66119.1|GT90	0.0	1	984	1	873
CAK36993.1|GT90	0.0	1	983	1	995
BCS08186.1|GT90	0.0	1	983	1	995
UDD56219.1|GT90	0.0	5	981	5	991

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	4.23e-07	683	970	95	340	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	2.63e-06	706	971	154	378	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.29e-36	421	977	151	661	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|A0NDG6|RUMI_ANOGA	1.28e-09	701	971	158	385	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	5.33e-09	675	972	131	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	7.08e-09	838	972	264	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q29AU6|RUMI_DROPS	1.96e-06	844	971	272	388	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.891972	0.108013

TMHMM  Annotations     

Start	End
12	34
38	60
105	123
133	150
264	286
296	318
325	347
362	381
394	413