CAZyme Information: ASPSYDRAFT_1165062-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_1165062-t33_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
796	KV878599|CGC1	86126.28	5.3464

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878599:28182-30752(-)

Full Sequence      

MVQFKACFLLLNVVAAHAAVLQDDSYFYGQSPPVYPTPNMTGAGEWGHALSKAQRLVAQM
SLEEKLSLTGGVKNDTSGCGGNIPAINRLGFPGMCLQDGPNGIKGSELVNGYPSGIHIGA
SWNKTLAYHQAHAIGGEFRRKGVTLALGPPVLGPLGRIALGGRNWEGYGKDPYLSGIMGA
ETVRGVQDNGVIACAKHFVGNEQELHRNPRLDAATNKTVESSSSNMDDKTMHELYMWPFA
DAVHAGVASVMCAYERLNNSYSCHNSKALNGLLKTELNFQGFVLSDWFAQHTGVASAMAG
LDMVMPYGNMYWGPNLTNAVHNGSVPESQINNMATRIMAAWYLSHQDDPELPPVGIGIPA
DYGKPHPVIDARNPDDEGVLLEGAIQGHVLVKIVNYALPLSSPRILSIYGYDAKVADTNI
AKAGINGWTQGLQAHDYRSVECGFGLTGGHCPPFAPIAPNGTIIGGGGSAAITPVYISSP
FQALDARARRDRTQLFWDLEGTQVTNIEADACLVFVNAASSEGVDRPALRDDYSDGLIID
IASQCNNTVVIIHNAGVRLVDQWIDHPNVTAVILAHLPGQDSGKAITQILYGDVSPSGKL
PYTLPRNESDYGSLLNPVTYSDCDRYFPQDNFTEGVFIDYRAFDRNGVTPRFEFRFGMTY
TTFEYANLKVLHTLELSGLSEYPTGPVIPGGNTDLWDTVAVVTADITNTGPVEAAEIAQL
YIQIPDEAQPVLQLRGFDKVTVPPGETRAVDFKIRRRDISIWDVASQKWRLIVGSQYPIF
VGASSRNIILNGTLEL

Enzyme Prediction     

EC	3.2.1.21:10	3.2.1.37:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	86	306	1.8e-58	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	1.84e-41	459	640	27	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	9.25e-39	84	340	53	311	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	2.24e-36	162	763	168	734	beta-glucosidase BglX.
395747	Glyco_hydro_3	7.92e-35	87	337	62	313	Glycosyl hydrolase family 3 N terminal domain.
405066	Fn3-like	4.00e-23	716	785	1	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW36032.1|GH3	0.0	1	796	1	796
QRD93012.1|GH3	0.0	1	796	1	796
UDD65245.1|GH3	0.0	1	796	1	796
QMW48093.1|GH3	0.0	1	796	1	796
BAE65597.1|GH3|3.2.1.21	0.0	1	796	1	796

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SZ6_A	2.02e-182	28	795	1	836	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
5JU6_A	2.05e-178	10	795	5	852	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
6JBS_A	8.16e-171	35	793	49	800	Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_B Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_C Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_D Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes]
5NBS_A	1.18e-170	17	794	6	856	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]
6JXG_A	1.83e-170	42	795	2	711	Crystasl Structure of Beta-glucosidase D2-BGL from Chaetomella Raphigera [Chaetomella raphigera]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A5ABF5|BGLM_ASPNC	1.34e-279	15	796	19	765	Probable beta-glucosidase M OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglM PE=3 SV=1
sp|Q0C7L4|BGLM_ASPTN	2.74e-273	21	796	26	782	Probable beta-glucosidase M OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglM PE=3 SV=1
sp|B8N5S6|BGLM_ASPFN	2.74e-272	10	796	11	768	Probable beta-glucosidase M OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglM PE=3 SV=1
sp|Q2UDK7|BGLM_ASPOR	4.45e-271	9	796	10	768	Probable beta-glucosidase M OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglM PE=3 SV=1
sp|Q5AWD4|BGLM_EMENI	1.91e-268	5	794	7	770	Probable beta-glucosidase M OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000265	0.999723	CS pos: 18-19. Pr: 0.9718

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_1165062-t33_1-p1.