CAZyme Information: ASPSYDRAFT_109832-t33_1-p1

Basic Information

• Species: Aspergillus sydowii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus sydowii
• CAZyme ID: ASPSYDRAFT_109832-t33_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498	KV878596|CGC2	55217.91	7.5997

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsydowiiCBS593.65	13717	1036612	138	13579

• Gene Location: location=KV878596:156753-158349(+)

Full Sequence      

MHIAFLSNPASGQVNVQFAMAQQLVDQGHLVTFLSAASCSSKIDRFRCAQQPCHQHLIRF
ISLGSGHTVRDFTAFIQTRMHLMRRVPGDPVSLETCIEAALGPADEHAATALRVRDHINE
VDPDMICVDALTPSLITGARLTRRKFILTIPCSPGLTALPGAFQPNLVAANRRGSWGTLF
ENMYLNLHEVIHSRRHADRRAKRRIIKRLGLKSYGASSDSALLPPHWEDENCVASIHFNT
QGLIDCPNQSSKTIFVGAGVATEPSPSPLTPPPTTPSTPSLTPAGFPELAWMDEASVLGQ
DVVYINMGSMFIWEPAEFRACIEGFTAAHKRLNGRVRFLFKINSLPRTPSSNSNSNSSPK
KDLVAAEEEDIDLPPFIRLTHWISNQTAIYTHPALKAFIHHGGGNSFNEAVHFAIPQLVL
SQWLDTHEYATYAHKFGLGLRSEHPPWVESGDIERKVLELLGPRWDEFKANCRWWAYRSE
LGGGPEAAARIVLFHAQQ

Enzyme Prediction     

No EC number prediction in ASPSYDRAFT_109832-t33_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.11e-27	1	492	1	402	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	5.55e-10	299	492	236	395	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
178170	PLN02555	4.80e-04	378	480	340	447	limonoid glucosyltransferase
278624	UDPGT	0.004	378	416	325	362	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS27825.1|GT1	8.98e-314	1	497	1	491
EAA58772.1|GT1	7.43e-194	1	497	1	439
ATY63993.1|GT1	3.86e-171	1	498	1	475
CDU26159.1|GT1	8.12e-119	1	492	1	562
SJX63359.1|GT1	6.23e-118	1	492	1	562

PDB Hits     

ASPSYDRAFT_109832-t33_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A0D1DZV5|EMT1_USTMA	4.71e-120	1	492	1	558	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|M9MH90|EMT1_PSEA3	7.04e-120	1	496	1	563	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1
sp|A0A411KZY6|BUAB_ASPBU	3.21e-09	286	453	263	430	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A0M4KE44|CGT_MANIN	3.43e-06	291	462	265	427	UDP-glycosyltransferase 13 OS=Mangifera indica OX=29780 GN=CGT PE=1 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	8.37e-06	377	439	366	429	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000084	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ASPSYDRAFT_109832-t33_1-p1.