CAZyme Information: ASPNIDRAFT2_190824-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_190824-t41_1-p1
• CAZy Family: GT4
• CAZyme Description: Glycoside Hydrolase Family 75 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244	ACJE01000016.1|CGC7	26355.35	4.4361

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000016.1:1152728-1153611(+)

Full Sequence      

MHLLTTLLLSTTTTITTLLATAYSIPPNLSALYNKHKSKPCLHPLATGFHDGQNPTDSTF
TYCSDLSNKSIFLHSPTLGGRYDNMDIDCDGANSHGGNCGYDESIQDQTSFKDLVVSQYG
IPDLDANIHPYVVFGNTDYDPQRDGMWPLSVMVVVCGNQLFYGIWGDTAGGSWTGEASIA
LAKLCFPDDGMSGDNGHVGDDVLYIGFVGREAVPGGRANWKAGSTWEFEESIRGLGERLV
ATLT

Enzyme Prediction     

EC	3.2.1.132:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	12	241	8.6e-79	0.9772727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	3.80e-86	85	241	1	164	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK38717.1|GH75	1.11e-181	1	244	1	244
BCS01108.1|GH75	4.48e-167	1	244	1	242
BCS12861.1|GH75	4.48e-167	1	244	1	242
AJG44374.1|GH75	2.65e-94	19	244	15	241
BAE63840.1|GH75	9.29e-86	20	243	15	243

PDB Hits     

ASPNIDRAFT2_190824-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	7.72e-94	19	244	15	241	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	1.65e-86	20	243	15	243	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	1.65e-86	20	243	15	243	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1
sp|Q2U1H5|CSNB_ASPOR	5.49e-84	20	243	15	239	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q875I9|CSN_ASPFM	2.33e-77	20	243	15	236	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.229729	0.770271	CS pos: 24-25. Pr: 0.5351

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_190824-t41_1-p1.