CAZyme Information: ASPNIDRAFT2_181794-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_181794-t41_1-p1
• CAZy Family: PL4
• CAZyme Description: Carbohydrate-Binding Module Family 50 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
541	ACJE01000008.1|CGC9	58842.64	6.1387

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: transcript_product=Carbohydrate-Binding Module Family 50 protein

Full Sequence      

MTGIAANCNRWYTAQKGDNCYAVEKAFGLTPQQFQQWNPAVSLDCLVNFWAGYAYCVGVG
PAANGPHGPTMPGIAPNCIQFYTAKKGDTCYAVEKAFGISPQQFQQWNPAVSLDCLVNFW
PDYAYCVGVGPVAPTLTSTVTATATSASTSTTLTTSTTTMVTTNPNYSTRNPITSYNQTI
TPIDTAWPPTKTHPGQPKNCDKWHLVAPGDTCRSIYQRHGNRITMDELLEWNPDLKADCD
YPIAGYWVCVGIKRPALTIIYPTTNGTAPDPTPWTPRPLPTETAVYPPTKTQPGLAPSCS
AYYEAQPSDTCDQILASNPMLKFPLLFEWNPALKADCSGILPGYFYCIAAYNSTNLPSPP
TVTNQPYPMKAGTAKNCTAWYKKEDGDTCDLIVEMFGTFDKAQFVAWNPAVGVKCIGLEN
GYYYCVADPSTPKTRTRPVSTTVTFPTAHPRQPGVTKDCNKWWLVSVHDDCYDIIHFNGI
TMADLYTWNPALSGKRNCLEGLVPDMEICVGVSSMSTTTASSTVPGISGSTGLVTIVGGR
D

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	7.14e-09	80	116	1	37	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	7.35e-08	10	46	1	37	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	2.28e-06	81	114	1	34	Lysin motif.
396179	LysM	9.22e-06	82	108	1	27	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
197609	LysM	1.74e-04	11	57	1	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK42252.1|CBM50	0.0	1	540	117	794
BCS02341.1|CBM50	7.35e-266	160	541	1	386
BCS14019.1|CBM50	7.35e-266	160	541	1	386
QMW40446.1|CBM50	3.15e-132	66	512	32	489
UDD56385.1|CBM50	3.15e-132	66	512	32	489

PDB Hits     

ASPNIDRAFT2_181794-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	4.82e-40	8	426	45	455	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4AVW3|LYSM5_ARTBC	5.95e-16	1	59	478	536	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|D4B4P8|LYSM2_ARTBC	5.49e-15	78	253	29	182	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AZ68|LYSM3_ARTBC	3.20e-11	299	426	268	406	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1
sp|D4B5F9|PGDA_ARTBC	2.60e-10	70	129	379	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998613	0.001400

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_181794-t41_1-p1.