CAZyme Information: ASPNIDRAFT2_1210369-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1210369-t41_1-p1
• CAZy Family: GT2|GT2
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587		65116.35	5.1311

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000008.1:933990-936075(-)

Full Sequence      

MTVPVEDNFDFVVVGGGTAGNVVAGRLAENPDVRVLVIEAGVSNPGEISEITTPSSAFGL
RDSQYDWAYKSTMINKPYYERVEKPNTRGKVLGGSSSLNYYTWIRGSKGTFDAWAEYGGP
SWNWDGCEEYFNKPATYHDDDNLYPSELSRIGRNGPLHVSHADLVPELHTFRDALTEAWT
SKGQKTCEDIYSGKMEGLTHCVNSIYGGVRSTSASYLTDKPNVTILSSAIGKKVNFDGVK
ATSVTVIGADRTELTFTAKYEIILACGVFETPKLLMLSGIGAKDELARHGIDSVVDSEHV
GQNLHDHPILAHVFRLKDGTGLDGHLLRAGPAQSAALQKYRTSKKGPFSSGLLEMVGLPR
IDDRLERYKEYREAKAQNDGRDPFGPEGQPHFEIDFVREDIDELQPMFSDAFQWHFPVPP
EGDWLTVIVDLLRPLSRNGEVKLNSADPHQQPYINLNFFSNELDILALREGVRFVDDILM
TGDGMKEILGEDYPWPMPRHSDEAMNKMILERSQTGYHPCGTARLSKDIAQGVVDPELRV
HGVQNLRVVDASIIPLIPDCRIQNAVYMIGEKGADMIKAAYPALYRS

Enzyme Prediction     

No EC number prediction in ASPNIDRAFT2_1210369-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	579	2.5e-153	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.33e-105	9	578	6	532	choline dehydrogenase; Validated
225186	BetA	1.78e-101	2	586	1	542	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.42e-44	434	572	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.70e-28	9	570	56	569	Protein HOTHEAD
366272	GMC_oxred_N	1.33e-25	88	309	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS02092.1|AA3_2	0.0	1	587	1	580
BCS13779.1|AA3_2	0.0	1	587	1	580
CAK97252.1|AA3_2	0.0	1	587	1	545
ATZ50069.1|AA3_2	1.38e-297	1	586	1	578
AEO67525.1|AA3_2	5.71e-295	2	585	4	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	4.06e-257	8	585	6	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	1.16e-256	8	585	6	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	3.31e-256	8	585	6	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	1.68e-74	8	579	1	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	9.18e-74	8	579	2	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	1.97e-73	4	580	2	536	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|B7N8L3|BETA_ECOLU	3.46e-64	9	578	3	532	Oxygen-dependent choline dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) OX=585056 GN=betA PE=3 SV=1
sp|Q0R4L2|PDH3_LEUMG	4.42e-64	4	581	36	599	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q0T7N0|BETA_SHIF8	9.43e-63	9	587	3	540	Oxygen-dependent choline dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) OX=373384 GN=betA PE=3 SV=1
sp|B1XE52|BETA_ECODH	1.31e-62	9	578	3	532	Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain K12 / DH10B) OX=316385 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000015

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_1210369-t41_1-p1.