CAZyme Information: ASPNIDRAFT2_1181125-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1181125-t41_1-p1
• CAZy Family: GH81
• CAZyme Description: acetylxylan esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418	ACJE01000002.1|CGC3	46733.49	4.5725

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000002.1:539366-541131(-)

Full Sequence      

MRLSPIYALSWALQASATILQNGQVREDPYPGQAKAISLDNGSWRTYQPDASEIAYKGRW
DSKHVSWWSLPGIKLGFTGEQLAVSFGPQTSEGVLLAYRIDGLDWQFSNVTANSTYQFAG
SWTPGLDLSKNNTFEMRGKCSSPSIETHTDIQLAGVSVASDSQLVTVPQYNKTVEIIGDS
FASGQYGTYEGLSSWAYNYAAGLGDVEYSITAYPGICLTDEQCYADKARGMTHQWFYASD
AGVRANATYGNQPEKWDFSAHRAADLVIIDLGTNDHRAVNDIPGSTFYDSYVELVTSVHE
TWPDAQIVIMSLWGNFTRSGDTYVQSPFYVSEIQRVAEHFQDDGFVYYFDTKGVLQHNDI
DPQEHPTDVGHIKVASHLMQWTKLKLGWEFGATGPEVQHDTLYWNNEDSYRRSFTGSY

Enzyme Prediction     

No EC number prediction in ASPNIDRAFT2_1181125-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	175	380	2.9e-21	0.9760765550239234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	1.22e-47	174	383	2	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238141	SGNH_hydrolase	1.96e-14	174	380	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	4.29e-14	176	371	1	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
239946	SGNH_hydrolase_like_7	0.002	256	344	13	152	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
395531	Lipase_GDSL	0.003	262	378	77	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK41944.1|CE0	1.86e-252	1	418	1	383
BCS11519.1|CE0	1.94e-250	68	418	39	376
QMW34907.1|CE0	7.54e-200	6	413	5	401
QMW46983.1|CE0	7.54e-200	6	413	5	401
QRD91240.1|CE0	7.54e-200	6	413	5	401

PDB Hits     

ASPNIDRAFT2_1181125-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPNIDRAFT2_1181125-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.159874	0.840120	CS pos: 17-18. Pr: 0.6942

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_1181125-t41_1-p1.