CAZyme Information: ASPNIDRAFT2_1178550-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1178550-t41_1-p1
• CAZy Family: GH76
• CAZyme Description: Glycoside Hydrolase Family 28 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
443		47834.25	4.0390

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000019.1:1615975-1617850(-)

Full Sequence      

MLVTPLIALLPAIAAAQVSGTVGPRTSASAKAAEKVCNVLDYGASANSTNDIGPPLKEAF
QDCQTGGLVYIPEGNYLLSSWVSLVYGSGWALQLDGIIYRDKNVTDGGNMIFIEHTNDIE
IFSNNSAGAIQGYGYLFHEQDEYGPRILRLNNVTDFSVHDLILVDSPAYFLNLVESYNGE
VYNMVIRGASMGGLDGIDISGANYWIHDVEVTNGDECVTVKSPSANVRVENVFCNHSGGC
AMGSLGTDTNISNIEYENIYTYNSTQMYMIKSNGGNGTVTNCSFKNFIGYSNAYMLDLDT
YWGDQSDGDGIKYENIGFENWKGTSSNGIQRSPIRILCPDENPCTNITLTAVELWTDTGD
YVKQECSSAYGEGECLRQQNGTLASYSFTTTITSVPVTAYSPTTTMPGLISTSMDTTTSI
PIPTIPTSFFPGASAYSTLMANM

Enzyme Prediction     

EC	3.2.1.171:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	61	367	1.7e-53	0.9538461538461539

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215426	PLN02793	1.81e-24	25	371	40	411	Probable polygalacturonase
215540	PLN03010	8.37e-16	38	372	48	392	polygalacturonase
177865	PLN02218	1.14e-13	38	354	69	408	polygalacturonase ADPG
395231	Glyco_hydro_28	7.88e-13	145	354	85	303	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
178580	PLN03003	1.86e-12	118	407	111	420	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK96934.1|GH28	7.43e-310	1	443	1	443
ABD61570.1|GH28	7.43e-310	1	443	1	443
BAE66335.1|GH28	7.11e-174	6	442	11	448
UDD65679.1|GH28	7.11e-174	6	442	11	448
QKX61550.1|GH28	7.79e-174	8	442	9	442

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	9.38e-166	17	439	1	420	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
4C2L_A	2.04e-22	33	359	15	365	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QWT2|RHGD_ASPNC	1.32e-310	1	443	1	443	Putative rhamnogalacturonase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgD PE=3 SV=1
sp|B0Y0Q3|RHGB_ASPFC	1.15e-177	6	442	11	446	Probable rhamnogalacturonase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=rhgB PE=3 SV=1
sp|Q4WV23|RHGB_ASPFU	1.15e-177	6	442	11	446	Probable rhamnogalacturonase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=rhgB PE=3 SV=1
sp|A1DED1|RHGB_NEOFI	2.76e-177	6	442	11	446	Probable rhamnogalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=rhgB PE=3 SV=1
sp|Q2TWN8|RHGB_ASPOR	1.26e-174	6	442	11	448	Probable rhamnogalacturonase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rhgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000273	0.999697	CS pos: 16-17. Pr: 0.8516

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_1178550-t41_1-p1.