CAZyme Information: ASPNIDRAFT2_1163420-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1163420-t41_1-p1
• CAZy Family: GH47
• CAZyme Description: Glycosyltransferase Family 32 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470	ACJE01000006.1|CGC2	51719.32	6.5823

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000006.1:1058020-1059733(-)

Full Sequence      

MCLGQTKAIRFNGLFIFQCGDCPYVAVPCPTSLKGTGSVPTPTDGGLSAEKPRVAMIQPH
FNARATHGWTLSAGPGAPRIFLISFHLQYPHESSSSCTPSMLPSTLKSSRYGRFVILTIP
LLVFSCLLFLTWDPLPGRLARQQSTSQSDPLSQVPQAVEPPKEEPSQPKTPVSTSKPSSS
KPTADIAGGDAIFGITDKLWQSAKDPHLSDDQDEWISSWLVKNPSFRYELLTDTSAATFV
RTHYASRPDIIEVFETLPIPILRADLLRYLLVLAEGGVWSDLDVTCDKPVADWVPTEYKN
AKIEMIVGLEFDFEWRGEGTEIASQFCNWVFAAPRSSRVLQVVVDAVVDKLKEIAAMNNV
QVKDLTLEMLPIDVVNVTGPKIMTMAILDSLKQLLGRTVDDRDFHGIKKPKLIGDVLIMP
GVAFAASQNGYPQDQGDALVTHHYAGSWKQADAEAKEKKKQKQNGRDKVV

Enzyme Prediction     

No EC number prediction in ASPNIDRAFT2_1163420-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	214	296	4e-19	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.63e-17	195	312	82	198	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.45e-14	216	298	8	91	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46331.1|GT32	3.53e-289	69	470	20	421
BCS02801.1|GT32	1.28e-253	74	470	7	407
BCS14453.1|GT32	4.47e-241	101	470	1	373
QKX62870.1|GT32	2.03e-124	101	463	1	378
QQK48128.1|GT32	2.11e-124	177	462	68	353

PDB Hits     

ASPNIDRAFT2_1163420-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.18e-28	199	449	146	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	1.08e-21	199	424	134	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	4.33e-21	214	449	122	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	7.77e-14	190	341	91	276	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	4.24e-06	191	288	56	147	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000034

TMHMM  Annotations     

Start	End
111	133