CAZyme Information: ASPNIDRAFT2_1160525-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1160525-t41_1-p1
• CAZy Family: GH32
• CAZyme Description: Glycoside Hydrolase Family 78 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1159	ACJE01000020.1|CGC6	126127.30	6.3118

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000020.1:1141868-1145645(-)

Full Sequence      

MGLCVGWRWILLCVVMGAAVCGTDKTATMRWHKLLPGVLALLPLSVAQSCWRNTTCSGPT
ESAFSGPWEKNIFAPSSRTVNPEKLFLITQPDKTEEYSPFALHGNGSLVVYDFGKEVGGI
VSVNFSSTGSGALGVAFTEAKNWIGEWSDSSNGGFKGPDGALYGNFTEAGSHYYVMPDKS
LRGGFRYLTLFLITSDNSTIQIEDVNLEIGFQPTWSNLKAYQGYFHSNDDLLNKIWYTGA
YTLQTNEVPTDTGRQIPAMAVGWANNCTLGPGDTIIVDGAKRDRAVWPGDMGIAVPSAFV
SLGDLDSVKNALQVMYDTQNNSTGAFDESGPPLSQKDSDTYHMWTMVGTYNYMLFTNDSD
FLERNWEGYQKAMDYIYGAELATWAGDSGDLSSTWTSRAEKLRQAINEYCWDDSYGAFKD
NATDTTLHPQDANSMALLFGVVDADRAASISERLTDNWTPIGAVAPELPENISPFISSFE
IQGHLTVGQPQRALELIRRSWGWYYNNANGTQSTVIEGYLQNGTFGYRSDRGYYYDTAYV
SHSHGWSSGPTSALTNYIVGISVTSPLGATWRIAPQFVDLQSAEGGFTTSLGKFQAGWSK
TDKGYTLDFTVPHGTQGNLTLPFVSAAKPSIKIDGTEISRGVQYANSTATVTQNSMTSPP
ISPPNPILDQPSNQGSSNHVLLIIRSAHFHRIPILLQTRLYIHLQSNPTQPNTTHKMPPI
PPSLRAARAQWRTCAQHLHASTHPPKTRLYSTTRTLRSSTTASSTTTASSNPLRNARPIR
SREQDLARSKRSMYISATGMIVCAIGMYGVIKADVFGLEQATPTSTTEGIDIENATSSNS
SATKLDGPSTGFPTKPTLTHIKAADGTTDQVETGTSTIPHFPAVIHLPKWLESENPPASA
TDLPTQSGTGTGEGEGEEYHLLGLGIRTVSFLNFQVYVVGLYVAKEDLAELQSRLVRTAV
HPPGKGTESVIDNEVGATAATSLVSMERDKLRELLLDAEKGEQAWDMLLRKDGLRTAFRV
VPTRNTDFLHLRDGWVRGITGRAQKYNKESGGEFEGEEFGQAMGEFKGLFGGGQRKSVPK
GQVLVLARGAKGQLDVLVQGGGSGKDGVPDRYLGRVKDERISRLVWMNYLAGKNVSSEGA
RQSVVDGIMGVVERPVGTV

Enzyme Prediction     

EC	3.2.1.174:2	3.2.1.174:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	378	621	4.7e-48	0.4444444444444444
GH78	108	376	1.4e-40	0.4583333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406443	Chalcone_2	5.27e-85	919	1145	3	203	Chalcone isomerase like.
407469	Bac_rhamnosid6H	5.21e-08	223	456	4	253	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	1.44e-06	560	622	1	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
225922	SGA1	3.09e-05	141	499	147	562	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK43282.1|GH78	0.0	29	1159	1	1131
UCK57529.1|GH78	0.0	34	652	12	674
QRD88907.1|GH78	0.0	34	652	12	674
QMW37218.1|GH78	0.0	34	652	9	662
QMW25160.1|GH78	0.0	34	652	9	662

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	2.99e-09	185	592	273	670	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6BN19|AIM18_DEBHA	1.07e-23	898	1151	78	297	Altered inheritance of mitochondria protein 18, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=AIM18 PE=3 SV=1
sp|Q75DU9|AIM18_ASHGO	1.88e-19	918	1152	99	304	Altered inheritance of mitochondria protein 18, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=AIM18 PE=3 SV=1
sp|Q6CWH8|AIM18_KLULA	8.75e-17	918	1145	109	308	Altered inheritance of mitochondria protein 18, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=AIM18 PE=3 SV=1
sp|C5DFS5|AIM18_LACTC	3.84e-14	918	1143	99	296	Altered inheritance of mitochondria protein 18, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) OX=559295 GN=AIM18 PE=3 SV=1
sp|A7TPW4|AIM18_VANPO	2.71e-12	918	1152	110	316	Altered inheritance of mitochondria protein 18, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294 / BCRC 21397 / CBS 2163 / NBRC 10782 / NRRL Y-8283 / UCD 57-17) OX=436907 GN=AIM18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.617594	0.382400

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_1160525-t41_1-p1.