CAZyme Information: ASPNIDRAFT2_1159216-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1159216-t41_1-p1
• CAZy Family: GH31
• CAZyme Description: Glycoside Hydrolase Family 3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1102	ACJE01000014.1|CGC1	119677.24	8.0017

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000014.1:605952-609874(+)

Full Sequence      

MIYLLPRDFLSHRAQSIRLYTLAFDNFDFMPLELLAPSQPVVSAAVNRISDRQNIASSYL
VTYLIEGSLVSTAGAGAPVRPLFFDVCNRLPYSLGLPRFRPISGCVSVPYLQRLSPISPT
TAATITAATATYPIHHPETRFLYFAIAPATFLPTPGSHGPQRGHVAAWLGGSRQDVTLLA
LVGLILSSIPSIHPSPSLFRFPLSTFITLKKHPLPSSLPFYPSIMADAAEDATRLVLELQ
TIARDAGHPVPLLIALDQENGGVNSLYDEIYIRQYPSAMGIAATGSKTLAHEVATATAQE
LKAVGVNWILGPVLDVLTNVRSQPLGVRTTGDDPQEVSQYGVEFMKGYQKAGLVTCGKHF
PSYGNLEFLGSQTDVPIITESLEQLSLTALVPFRNAIVQGLDSMMVGGVSMSSAGVNVMH
ACLSEQVVDDLLRKDLKFEGVVVSECLEMEALTHNIGVGGGTVMAKNAGCDIILLCRSFQ
VQQEAINGLKLGVENGIIGRARIEQSLRRVLKLKAKCTSWERALNPPGIPSLTQMQPSHT
SLSTRAYNSSISVVRDKKNLLPLSNILESNEELLLLTPLVKPLPASAVSRSVSEHSNMSL
DPISWDRTASVLSGESVFKELGRSLSRQRSGRVLHTSYTANGVRPIHENLIDRANAVIVV
TADANRNLYQHGFTKHVSMICRSQFTPSGEAREKPLIVVAASSPYDFAMDPSIGTYICTY
DFTETALEALVKVLYGELNPVGSLPGSISRSQKLHQARQHWLVETWNEERDARSLDSLLD
AVRGDCAQGQRSELLGVTSSSFMLRREEIDEAHFVVRNSSTQALYGFCSTYFFRSTGTGV
IGSLIVHPARRKLSIGNSLHSRAIRTLLQRKGVKRFQLGSRLPGIYLGIPSANPVERKRL
RQWFANLGWNTALSRPVCSVVLRNLTTWTPPDGLVFGLQNADVTYDLVHGWDHADSILDH
IKTNSRQGVIDIYRVALGGAPHCGIIRATRPGDGAILGSVVIYNGRATLAEHMPALKSTQ
VPAGGISSPVISPSVGEYATVMQGLVLLGIKQIRKQGAEAVIMDSVDVDGNFECLSGLGF
STLHSFEEVNCDAATWTMVPGP

Enzyme Prediction     

No EC number prediction in ASPNIDRAFT2_1159216-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	249	474	1e-53	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.56e-63	207	564	22	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	2.09e-53	230	513	46	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	1.16e-29	244	509	50	308	beta-hexosaminidase; Provisional
178629	PLN03080	1.95e-12	275	745	114	585	Probable beta-xylosidase; Provisional
185053	PRK15098	1.74e-07	274	514	119	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK47105.1|GH3	0.0	1	1102	1	1107
BCS15461.1|GH3	0.0	228	1101	57	930
BCS03847.1|GH3	0.0	228	1101	39	912
BAE65506.1|GH3	0.0	228	1099	86	958
QRD92904.1|GH3	0.0	228	1099	39	911

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	1.80e-73	184	909	16	679	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	3.16e-52	225	749	53	532	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	8.45e-34	233	748	99	617	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.20e-33	233	748	73	591	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.57e-33	233	748	103	621	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	4.35e-33	233	748	99	617	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	2.81e-32	229	745	67	552	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P48823|HEXA_PSEO7	4.99e-27	239	749	87	597	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	2.29e-23	251	503	58	308	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|B0U3L0|NAGZ_XYLFM	3.05e-22	236	500	40	306	Beta-hexosaminidase OS=Xylella fastidiosa (strain M12) OX=405440 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000023

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_1159216-t41_1-p1.