CAZyme Information: ASPNIDRAFT2_1159100-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1159100-t41_1-p1
• CAZy Family: GH30
• CAZyme Description: Glycosyltransferase Family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542		60941.42	6.9419

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000013.1:1641860-1643552(-)

Full Sequence      

MAMSDIILPPRKILLVVTGGGYTHAAPVLELGKVLANRGHVVDFATLDGQEEWASGFQIS
STHLMGPGPTEEQLDAHYMRSRLWDPARGLGDVMESKYLFDSLWTQSYYGLKTIMDDPAT
RPDMLVADFFVDAVKDIQLEYKVPIAIVWPQMPYLMVPCSYIPGQPGFQLDMTLTSENAS
MWSRINNELVVVRALPEVFKLRNWTRAMRKRAGLNYLLPTPKKPNYLLLVNSFFGLEVPK
DLPPLVAAVGPILADEYPLLDAPHQEFLDRHPKTIYIALGTHIILPHADARKILQGLIQA
MEEGVIDGVIWSVGRSGRQLFDNAESFTMQGKTISFGDLLEGLHADWKFPFFAPQRSILD
HPHTRIYFTHGGGSSANEGLYHGKPMLVMSFFFDQIGNAAKLAGNGTSELLHKFRFTADE
LYFKTKLIMEDRDGCYARNVQRLQRIAHVASRRKYLGADLIEEVLYDNESRVVDGKETRP
MHLQTADMRMPAYKAKNWDLMAVSGVVMGLLGGGLYYAGRLAWINRRAIDGFVDGLVCKI
YN

Enzyme Prediction     

No EC number prediction in ASPNIDRAFT2_1159100-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	117	447	2.9e-26	0.7198952879581152

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.84e-40	15	463	4	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	7.50e-19	12	465	3	399	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
278624	UDPGT	2.63e-12	353	448	330	423	UDP-glucoronosyl and UDP-glucosyl transferase.
177813	PLN02152	3.46e-08	116	452	104	438	indole-3-acetate beta-glucosyltransferase
223071	egt	1.21e-07	178	446	197	445	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46937.1|GT1	0.0	1	542	1	527
QKD56593.1|GT1	6.59e-249	9	539	6	538
QLI65751.1|GT1	3.20e-241	10	536	5	533
QKX59607.1|GT1	9.90e-235	9	537	8	541
BCR88254.1|GT1	7.02e-232	3	528	1	532

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	3.17e-11	280	448	19	191	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	1.64e-08	354	442	78	164	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
5NLM_A	2.53e-07	121	402	116	403	Chain A, indoxyl UDP-glucosyltransferase [Persicaria tinctoria],5NLM_B Chain B, indoxyl UDP-glucosyltransferase [Persicaria tinctoria]
6SU6_A	2.61e-07	121	402	137	424	Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and UDP-glucose [Persicaria tinctoria],6SU6_B Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and UDP-glucose [Persicaria tinctoria],6SU7_A Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and 3,4-Dichloroaniline [Persicaria tinctoria],6SU7_B Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and 3,4-Dichloroaniline [Persicaria tinctoria],6SU7_C Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and 3,4-Dichloroaniline [Persicaria tinctoria],6SU7_D Complex between a UDP-glucosyltransferase from Polygonum tinctorium capable of glucosylating indoxyl and 3,4-Dichloroaniline [Persicaria tinctoria]
6PNT_A	6.74e-06	352	431	324	401	Structural Characterization of UDP-glycosyltransferase from Tetranychus Urticae [Tetranychus urticae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P06133|UD2B4_HUMAN	2.18e-13	155	448	187	450	UDP-glucuronosyltransferase 2B4 OS=Homo sapiens OX=9606 GN=UGT2B4 PE=1 SV=2
sp|O02663|UD2B9_MACFA	5.08e-13	92	448	129	450	UDP-glucuronosyltransferase 2B9 OS=Macaca fascicularis OX=9541 GN=UGT2B9 PE=2 SV=1
sp|Q9GLD9|UDB33_MACMU	1.18e-12	92	446	129	448	UDP-glucuronosyltransferase 2B33 OS=Macaca mulatta OX=9544 GN=UGT2B33 PE=1 SV=1
sp|O97951|UDB18_MACFA	1.57e-12	156	448	188	450	UDP-glucuronosyltransferase 2B18 OS=Macaca fascicularis OX=9541 GN=UGT2B18 PE=1 SV=1
sp|P36537|UDB10_HUMAN	2.07e-12	158	448	189	449	UDP-glucuronosyltransferase 2B10 OS=Homo sapiens OX=9606 GN=UGT2B10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000001

TMHMM  Annotations     

Start	End
497	519