CAZyme Information: ASPNIDRAFT2_1151059-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1151059-t41_1-p1
• CAZy Family: GT90
• CAZyme Description: Glycoside Hydrolase Family 78 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343		38190.09	7.0315

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000008.1:1085065-1086234(+)

Full Sequence      

MSGDTQTSRLLPADAGLLYPECKIQQPPRTKDVQANTTGLIGYSFNLLSAMAKLYEQTGD
EVFLHRWAPKAVRMLDWAYSQTLPNHLLNITDPGLGGGWDYSDPTSSGIVTQFNILYAYS
LKKWISYLSQANINATMYQRRLNNLQKAINDHLWSEELQAYYHSEAYQDFFSQDANALAI
LSDTTHLTGNPFHANDAVNAKRLLHSIWGPMSDPRHANYTGCMWEVMSPDGTPGLGSLTS
LCHAWSAGPTADLSHYVLIISPSPLALRSGKSHLRLWVWPGHGENILPPHGNIMVDWSFN
CSGHFNIAVSTPVGTRCTVALPSSLNRTLEVQDGKVFRYKQHT

Enzyme Prediction     

No EC number prediction in ASPNIDRAFT2_1151059-t41_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	6.28e-07	54	180	110	233	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	0.003	289	337	32	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW46762.1|GH78	8.25e-113	16	329	429	788
QMW34696.1|GH78	8.25e-113	16	329	429	788
BAE56658.1|GH78	1.30e-112	16	329	390	749
QRD93478.1|GH78	4.69e-111	16	329	625	984
UDD63660.1|GH78	6.37e-111	16	329	642	1001

PDB Hits     

ASPNIDRAFT2_1151059-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPNIDRAFT2_1151059-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000001

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_1151059-t41_1-p1.