CAZyme Information: ASPNIDRAFT2_1147378-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1147378-t41_1-p1
• CAZy Family: GH20
• CAZyme Description: Glycosyltransferase Family 69 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430	ACJE01000020.1|CGC5	48985.03	6.0772

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000020.1:160296-161588(+)

Full Sequence      

MTVRRPRIWRRFLLILGASAILFLLCRNDEPRWLAARRAHSSCTGFDLASVSEDLHSRMK
AESDYTPVEIHQFVCGIINHNMTASAQLECPATISQRYRSLIPVDGKHPEIQYFFALNLY
QVIHIILPLMGSILEAIRYLGPEHCALSIVEGRSTDGTYEILARLKPELDAMGVRYYFSR
SPINPLGPGENRIKDLSELRNMALEPLITGARQKGGPFGHDPMIIFINDIGICPEDILEL
IYQQKVQDATMTCAFDWREEGVIHDVWVSRDLSGDLFFDISSDGSIWDSHNLFSHHGPSR
ERFIKHLPVQVYSCWGGMVTLDSGPFIDGQVQFRYSEEDECYMGEPTLLAQDLWRLGLGK
VLAIPTVNVAYEYRWSLRAKNEKGYVHTLLGNPGPGRYSPHDELVHWQKEPPKQIKCMPA
WDDQSWVDAV

Enzyme Prediction     

No EC number prediction in ASPNIDRAFT2_1147378-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	112	354	3.1e-78	0.9916317991631799

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	1.35e-90	112	349	1	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK43148.1|GT69	0.0	1	430	1	430
BCR98251.1|GT69	2.28e-303	1	430	1	425
BCS10594.1|GT69	2.28e-303	1	430	1	425
BAE64674.1|GT69	1.74e-150	42	430	60	447
QRD91215.1|GT69	7.41e-150	42	430	72	459

PDB Hits     

ASPNIDRAFT2_1147378-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6U1Z4|CMT1_CRYNJ	5.62e-45	112	427	128	461	Alpha-1,3-mannosyltransferase CMT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997534	0.002489

TMHMM  Annotations     

Start	End
7	26