CAZyme Information: ASPNIDRAFT2_1147190-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1147190-t41_1-p1
• CAZy Family: GH2
• CAZyme Description: Glycoside Hydrolase Family 72/ Carbohydrate-Binding Module Family 43 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
537	ACJE01000019.1|CGC18	57197.82	4.1953

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: transcript_product=Glycoside Hydrolase Family 72/ Carbohydrate-Binding Module Family 43 protein

Full Sequence      

MKFSATTLAGASLLLGRAIAADLPAIEAKSNKFFYSNNGTQFFIRGVAYQQDYTSNGTDS
SNADYTDPLADASTCKRDIPYLQQLRTNVIRTYAVDPTKDHTECMQALQDAGIYLITDLS
APSTSINRDDPQWNTDLYSRYTSVVDAFANYTNVIGFFAGNEVANSQNNTNAIAYVKAAV
RDMKAYIKAKNYRSSLGVGYATDDDSTIRDDLKNYLVCGDSDDRIDFFGYNIYEWCGDSS
FKTSGYQARTEEFKDYPVPAFFSEYGCNSPSPRTFTDVPVLFGDQMNDVWSGGIVYMYFQ
EDNDYGLVSVDGSSVSTLKDFSNLSSQMLKATATGVNSNSWSASNTATPTCPSVGTAWEA
TNTLPPSPNEDLCSCMEASLSCVVKDSVKESKYGDLFDYICAKGDYCAGMSSNSTTGDYG
AYSVCSTKQQLSFVMNQYYEKQSAKASACDFSGDGTTTSSSAATGTCSSLLKEAGTAGTG
SVTSSPTGGGSVASASSSTSEGAGAGLSAPNAVQVGSWQLGAYAVTAVGAALGMILL

Enzyme Prediction     

EC	2.4.1.-:3	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	21	329	1.2e-137	0.9839743589743589
CBM43	381	468	2.2e-22	0.9879518072289156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	1.70e-170	18	331	4	314	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	4.72e-30	380	456	1	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	2.74e-23	380	469	1	85	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.
397119	Glyco_hydro_2_C	8.28e-04	38	311	11	283	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS16538.1|CBM43|GH72	0.0	1	537	1	537
BCS04977.1|CBM43|GH72	0.0	1	537	1	537
EAA62091.1|CBM43|GH72	2.82e-253	1	537	1	539
QRD81806.1|CBM43|GH72	4.53e-251	4	537	3	544
QMW27418.1|CBM43|GH72	4.53e-251	4	537	3	544

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	1.02e-130	24	449	34	466	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
5FIH_A	2.87e-130	24	449	34	466	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]
2W61_A	2.87e-130	24	449	34	466	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0C956|GEL4_ASPFU	2.37e-247	9	537	8	548	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel4 PE=3 SV=1
sp|B0XVI5|GEL4_ASPFC	2.37e-247	9	537	8	548	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel4 PE=1 SV=1
sp|P0C955|GEL3_ASPFU	1.22e-197	10	489	8	483	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel3 PE=3 SV=1
sp|B0XT09|GEL3_ASPFC	1.35e-197	10	489	8	483	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel3 PE=1 SV=1
sp|P56092|EPD1_CANMA	3.85e-195	11	482	13	476	Protein EPD1 OS=Candida maltosa OX=5479 GN=EPD1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000295	0.999673	CS pos: 20-21. Pr: 0.9536

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_1147190-t41_1-p1.