CAZyme Information: ASPNIDRAFT2_1145979-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1145979-t41_1-p1
• CAZy Family: GH18
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535	ACJE01000015.1|CGC13	57675.01	5.8816

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000015.1:78010-79617(+)

Full Sequence      

MSKTYEYVICGGGTVGCVLASRLSQAGHSVLVVEAGPEDYNDKIMSPVAAPHLHGTEWEY
NLMTAKQPGLGNRSVPNYVGKLLSGSSGINYGLWTRGHSVDYDSWAKAVGDERWNYANML
KFFKMAQTHHDPTGSPEKYGFSGPISTTAAARTYPLREQIRNAMLAAGLEYNPDTNGGSP
LGFGPFTENWKDALRQPASKAYDLSKATVLTNSVIARVNFDDSKTATGITLTDGTQYTAS
REVLVTCGAIKTPQLLMLSGIGPQQHLAQHNIPTIADLPVGENYHDKISATFFWKLRNPE
KGYALGSPLFNKPEFRHGNPIEWVATVPTPHAELIEAAQKDRIDAEDPYLQEPRGNVEVM
VAYAPIAGGGSEFRVPMDGNHISSPVVLLLPTSRGSVTLASADPTADPVLDPRYLDTETD
RAAIRAGMRVALRVMETDSAKEVIDGETPPPGHEPITSASSNADLDRRVQIVGSSFFQNG
GTAAMGTVVDTQCRVKGVQNLRVCDASVLPLPLAGHYQAPMYAFGEAVADMLLAQ

Enzyme Prediction     

No EC number prediction in ASPNIDRAFT2_1145979-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	3	534	2.7e-140	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	9.99e-99	1	533	2	532	choline dehydrogenase; Validated
225186	BetA	3.40e-89	1	534	4	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	9.91e-63	6	533	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.20e-39	391	526	1	141	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.45e-23	80	286	24	215	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK37991.1|AA3_2	0.0	1	535	1	535
QKX54325.1|AA3_2	2.98e-248	1	533	1	531
BCS16263.1|AA3_2	1.44e-148	1	533	1	552
BCS04695.1|AA3_2	1.44e-148	1	533	1	552
CAK40717.1|AA3_2	9.50e-144	1	533	1	552

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	3.44e-44	2	532	3	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZH7_A	9.80e-44	1	532	4	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS2_AAA	1.35e-43	3	532	6	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS1_AAA	1.35e-43	3	532	6	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	1.85e-43	3	532	6	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	0.0	1	535	1	521	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|Q0B711|BETA_BURCM	1.37e-53	2	532	3	532	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) OX=339670 GN=betA PE=3 SV=1
sp|A9AMZ9|BETA_BURM1	1.90e-53	2	532	3	532	Oxygen-dependent choline dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) OX=395019 GN=betA PE=3 SV=1
sp|B1Z034|BETA_BURA4	2.63e-53	2	532	3	532	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) OX=398577 GN=betA PE=3 SV=1
sp|Q47944|SDH_GLUOY	3.69e-53	1	532	1	527	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000005

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_1145979-t41_1-p1.