CAZyme Information: ASPNIDRAFT2_1145813-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1145813-t41_1-p1
• CAZy Family: GH18
• CAZyme Description: Glycoside Hydrolase Family 28 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370		38734.97	3.7571

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000014.1:97850-99016(+)

Full Sequence      

MPSAKPLFCLATLAGAALAAPAPSRVSDFTKRSTCTFTDAATASESKTSCSDIVLKDITV
PAGETLNLKDLNDGTTVTFEGTTTWEYEEWDGPLLRISGKDITVTQSSDAVLDGNGAKWW
DGEGTNGGKTKPKFFYAHDLDDSKISGLYIKNTPVQAISVESDNLVIEDVTIDNSDGDSE
GGHNTDGFDISESTYITITGATVKNQDDCVAINSGENIYFSGGTCSGGHGLSIGSVGGRD
DNTVKNVTFIDSTVSDSENGVRIKTVYDATGTVEDITYSNIQLSGISDYGIVIEQDYENG
DPTGTPSNGVTISDVTLEDITGSVDSDAVEIYILCGDGSCSDWTMSGIDITGGETSSDCE
NVPSGASCDQ

Enzyme Prediction     

EC	3.2.1.15:80

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	47	368	1.4e-77	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.95e-139	50	368	1	321	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	4.30e-28	101	362	157	420	polygalacturonase ADPG
215540	PLN03010	1.83e-25	112	369	149	395	polygalacturonase
227721	Pgu1	2.25e-24	92	286	189	398	Polygalacturonase [Carbohydrate transport and metabolism].
178580	PLN03003	7.02e-22	109	327	120	334	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK47020.1|GH28	3.93e-268	1	370	1	370
CAB72125.1|GH28|3.2.1.15	3.93e-268	1	370	1	370
A2R8F8|GH28	3.93e-268	1	370	1	370
AJD09825.1|GH28	4.59e-267	1	370	1	370
AGV40780.1|GH28|3.2.1.15	1.08e-265	1	370	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NHC_A	4.90e-181	33	368	1	336	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]
6KVE_A	9.23e-174	31	368	7	344	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	9.23e-174	31	368	7	344	Chain A, endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	1.08e-170	35	368	3	336	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
1IA5_A	2.80e-150	34	368	3	339	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P4W4|PGLRA_ASPNG	6.98e-269	1	370	1	370	Endopolygalacturonase A OS=Aspergillus niger OX=5061 GN=pgaA PE=1 SV=1
sp|A2R8F8|PGLRA_ASPNC	6.98e-269	1	370	1	370	Probable endopolygalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pgaA PE=3 SV=1
sp|Q8NK99|PGLRA_ASPKW	6.41e-265	1	370	1	370	Probable endopolygalacturonase A OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=pgaA PE=3 SV=1
sp|Q9P358|PGLRA_ASPAW	7.48e-264	1	370	1	370	Endopolygalacturonase A OS=Aspergillus awamori OX=105351 GN=pgaA PE=1 SV=1
sp|A1CVV8|PGLRA_NEOFI	1.55e-198	7	368	6	368	Probable endopolygalacturonase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pgaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000293	0.999708	CS pos: 19-20. Pr: 0.9797

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_1145813-t41_1-p1.