CAZyme Information: ASPNIDRAFT2_1141591-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1141591-t41_1-p1
• CAZy Family: GH16
• CAZyme Description: Glycoside Hydrolase Family 105 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
271	ACJE01000002.1|CGC15	30909.55	5.5888

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000002.1:736401-737216(+)

Full Sequence      

MAVFLTLAYVYEKTQNPVYLPWLDAWAEWAMHELPRTKQGGMQHATYLTENYQQLWDDTL
MMTVMPLAKIGKLLNRPDYVEEAKRQTLVHVKYLVDTSTGLWFHGWTFEDGGHNFARARW
ARGNSWVTMVIPEFVELLDLKEGDPIRLFLLDTLEAQCEALMGLQEESGFWHTLLDHPDS
YVEASATAGFAYGILKAVRKRYLPKKYRVVAEKAIQAVLSAVDETGELQQTSFGTGMGDS
LDFYKKIPLTAMPYGQAMAIMALGEYLRGHL

Enzyme Prediction     

No EC number prediction in ASPNIDRAFT2_1141591-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	1	268	3e-95	0.8042168674698795

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	1.56e-93	1	268	82	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	1.00e-85	1	268	75	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46529.1|GH105	1.11e-201	1	271	95	365
BCS11594.1|GH105	3.76e-193	1	271	95	365
BCR99290.1|GH105	3.76e-193	1	271	95	365
BBO93662.1|GH105	1.03e-165	1	271	97	367
CAP80991.1|GH105	1.03e-165	1	271	97	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	1.08e-126	2	270	113	380	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.24e-126	2	268	114	379	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	5.55e-120	1	268	94	370	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3K11_A	1.36e-19	55	268	199	412	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	1.45e-44	6	268	81	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P9WF04|UH105_ALTSL	2.10e-16	56	267	201	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	1.48e-08	71	225	10	169	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	1.48e-08	71	225	10	169	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.976400	0.023619

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_1141591-t41_1-p1.