CAZyme Information: ASPNIDRAFT2_1141589-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1141589-t41_1-p1
• CAZy Family: GH16
• CAZyme Description: Glycoside Hydrolase Family 93 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
290		31949.72	5.0074

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000002.1:708551-709423(-)

Full Sequence      

MVSISEDNGQTFVDHGEITRGKGDVDNVYLLEIGPGTVLAAFRNHDIGPGGPTHFRITVC
RSTDAGRSWSFASQAAEKPAPLGIWEPFMRLGRRPGEIQLTYSQEFAHNNQCTMLVRSYD
GGSSWSAPHCLHGAEDQRRDGMNGIARTWDQARNCEALVMVFETTTYGTFDVEALVSYDD
GETWGGRQQVYVPPQGHNAGAPQIASLGDGSLAVIFMCDEDFGEVNWTRNACVKVVFGSM
PHEGRIMWTRPTTVCADSSHWPGIFTLDDRRLLALYECGGPKAKTIALEW

Enzyme Prediction     

No EC number prediction in ASPNIDRAFT2_1141589-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	2	233	3.3e-56	0.7980456026058632

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	3.74e-09	30	229	19	229	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	4.13e-09	1	223	114	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR99274.1|GH93	3.36e-220	1	290	88	377
BCS11580.1|GH93	3.36e-220	1	290	88	377
EAA62412.1|GH93	4.32e-151	2	289	83	367
QMW42642.1|GH93	6.20e-149	2	288	94	378
QMW30589.1|GH93	6.20e-149	2	288	94	378

PDB Hits     

ASPNIDRAFT2_1141589-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPNIDRAFT2_1141589-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_1141589-t41_1-p1.