CAZyme Information: ASPNIDRAFT2_1138553-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1138553-t41_1-p1
• CAZy Family: GH15
• CAZyme Description: Glycosyltransferase Family 2 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
769	ACJE01000017.1|CGC2	86544.47	8.4767

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000017.1:346202-348717(+)

Full Sequence      

MHSPPPVEDADPGETPGPYWELCQGPPQVCSHDPDSIEWSHSDSMVAPVDEPLTEEIVIP
ESLLAAASIRQVWNQASLQPWFQQPVAPNPAEEVSVVKQRKPGANYPATGVNPGDARRRQ
TSHSGTLEEGRGTIYPLLEDQVIVETPYGPQGVHPTELQYIEPNRQGLEDGPGIVRAVSA
QPSIRPDTPPSIEPRRASQPTKAFRQSLRGVVDRARESSLGTLYNRATLVNIKHERRYWV
QLVIEYGTYTIYVAFVYFVLVGMPLWKGAVYWLYWLMRHKFILQGGWAIVISLAVFYSFT
PLLTTFEDDAPDHEFYESRRISPTAPDTALLIPCYRAASVLGRTLEAAVKIFPPSHIFVI
ANGDALSPIDHTEEVCRPYGVNHIWSPVGSKIIALFVGCYAAKRFRYALLIDDDCILPPN
FPVVVSRLSDTVRCIGYTIKAVAADSLPGTYCQQAQDLEYKLAGLQRTFAGRIGSATFPH
GAISLWERSFLRETLQDHPGFSISEDWFLGNSCRRLGGRIQMCSSVFVETHAPPSFLFAA
GKRRGGFGETTVFKQRFMRWNFFLVNGLRYNVIYLVKSWKLGVYEIGTKLFVLQELYETV
LAIIAPFVLPISLIVRPRFCIVLIMATFALYFLNVVIFNEVHLRLKQERVSLKVILLYYM
PYKTMIAIINVGSNYWSLYKYARYFAKRRPKLTEDHKAVGLVLKLEESAQNRGPGSTGLG
RNLTVRSVGVRRSNRMSSGPGLTALRNRWSLQSHAEEPEGTDVIIEHYT

Enzyme Prediction     

No EC number prediction in ASPNIDRAFT2_1138553-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	326	538	2.9e-33	0.9478260869565217

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404520	Glyco_tranf_2_3	1.54e-38	326	545	2	225	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
224136	BcsA	6.13e-17	326	676	54	413	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.76e-11	330	506	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
404513	Glyco_trans_2_3	5.19e-08	407	616	1	191	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
132997	Glyco_tranf_GTA_type	2.04e-07	331	421	2	94	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39025.1|GT2	0.0	1	769	1	769
BCR96819.1|GT2	0.0	1	769	1	768
BCS09305.1|GT2	0.0	1	769	1	768
QMW36583.1|GT2	1.71e-267	50	730	6	673
QMW48638.1|GT2	1.71e-267	50	730	6	673

PDB Hits     

ASPNIDRAFT2_1138553-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

ASPNIDRAFT2_1138553-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000014

TMHMM  Annotations     

Start	End
252	274
281	303
596	615
620	642
657	679