CAZyme Information: ASPNIDRAFT2_1129970-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1129970-t41_1-p1
• CAZy Family: GH12
• CAZyme Description: Glycosyltransferase Family 1 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456	ACJE01000021.1|CGC19	50575.90	5.5050

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000021.1:2805838-2807269(-)

Full Sequence      

MTIDTKVTPSGDHCSKPLIVIACTTIIGHTLPLLPHATTLTKQGFDVSFIGGQEFESLIR
KTGATFYPIKNLYSPESLDYVKTISDRIARTVWSLKTYFVDMTASRMKSLQAVLETLREK
HPNREVILIQELGYMGTWPFLLGAPLPKGYERFPKTLTFSTSPLLVSSVDTAPFGHSLPP
DPSDDGRARNAAMYAAEKAIRDDLVDYTNSVYASLGATMKVDQWLFDLWSTGHNILLQPC
SPSLEYPRSDLSPKVRFIGGTPRREIDPTTPLPEWWGELETNRRATNPKKVVFVTQGTIK
INYKDLVIPTVQAFANRPDVMVIGVLGVKGAALDDDFEIPDNAKAIDYLSYDAVLPYVDV
FVTNGGYGSFMHGVMNGVPMVLAGTVQDKGEVCMRGEWAGIGINLRTDTPSPKTIKESVE
QILSDPKYKARSVVIQRENEELDCVGSVQRYILEDD

Enzyme Prediction     

No EC number prediction in ASPNIDRAFT2_1129970-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	149	452	9.9e-32	0.680628272251309

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224732	YjiC	7.35e-40	28	454	13	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
340817	GT1_Gtf-like	2.38e-29	19	441	3	391	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
273616	MGT	5.47e-24	28	441	7	375	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
278624	UDPGT	5.32e-07	244	429	237	412	UDP-glucoronosyl and UDP-glucosyl transferase.
223071	egt	0.002	335	431	340	438	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39187.1|GT1	0.0	1	456	1	456
BCS13313.1|GT1	2.02e-279	1	456	1	455
BCS01597.1|GT1	2.02e-279	1	456	1	455
UQC81531.1|GT1	1.88e-123	10	454	114	556
UPK94024.1|GT1	8.25e-121	16	453	25	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6J31_A	1.33e-11	283	438	222	376	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6J32_A	1.35e-11	283	438	225	379	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6PNT_A	3.62e-11	274	448	242	424	Structural Characterization of UDP-glycosyltransferase from Tetranychus Urticae [Tetranychus urticae]
3WAD_A	1.01e-08	338	450	294	411	Crystal structure of glycosyltransferase VinC involved in the biosynthesis of vicenistatin [Streptomyces halstedii],3WAD_B Crystal structure of glycosyltransferase VinC involved in the biosynthesis of vicenistatin [Streptomyces halstedii],3WAG_A Crystal structure of glycosyltransferase VinC in complex with DTDP [Streptomyces halstedii],3WAG_B Crystal structure of glycosyltransferase VinC in complex with DTDP [Streptomyces halstedii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J4VV61|GT1_BEAB2	2.18e-105	28	453	30	455	UDP-glucosyltransferase 1 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=BBA_08686 PE=2 SV=1
sp|E7CQW6|UGTA1_STABO	1.71e-70	16	454	7	433	UDP-glucosyltransferase A1 OS=Starmerella bombicola OX=75736 GN=ugtA1 PE=1 SV=1
sp|E9L011|UGTB1_STABO	4.90e-68	16	454	5	429	UDP-glucosyltransferase B1 OS=Starmerella bombicola OX=75736 GN=ugtB1 PE=1 SV=1
sp|Q8KHE4|REBG_LENAE	1.41e-49	19	445	5	410	4'-demethylrebeccamycin synthase OS=Lentzea aerocolonigenes OX=68170 GN=rebG PE=1 SV=1
sp|Q9L555|AKNK_STRGJ	1.76e-08	186	438	167	405	Aclacinomycin-T 2-deoxy-L-fucose transferase OS=Streptomyces galilaeus OX=33899 GN=aknK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000006

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_1129970-t41_1-p1.