CAZyme Information: ASPNIDRAFT2_1126871-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1126871-t41_1-p1
• CAZy Family: GH105
• CAZyme Description: Glycoside Hydrolase Family 28 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406		42199.26	4.0393

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000018.1:55645-56928(+)

Full Sequence      

MTLYRNLLLLASLGLSYAAPSKVQRAPDSSLHARAVCTPTAGGDSSTDDVPAITEALSSC
GNGGTIVFPEGSTYYLNSVLDLGNCSNCDIQVEGLLKFASDTDYWSGRTAMISVSDVDGL
KLRSLTGSGVIDGNGQDAWDLFASDSSYSRPTLLYITGGSNLEISGLRQKNPPNVFNSVK
GGATNVVFSNLKMDANSKSDNPPKNTDGFDIGESTYVTITEVTVVNDDDCVAFKPSSNYV
TVDTISCTGSHGISVGSLGKSSDDSVKNIYVTGATMINSTKAAGIKTYPSGGDHGTSTVS
NVTFTDFTVDNSDYAFQIQSCYGEDDDYCEENPGNAKLTDIVVSSFSGTTSDKYDPVVAN
IDCGADGTCDISISGFDVKAPSGKSEVLCANTPSDLGVTCTSGASG

Enzyme Prediction     

EC	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	56	392	3e-67	0.9661538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	7.77e-46	90	394	28	317	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	9.55e-34	41	391	54	388	polygalacturonase
178580	PLN03003	1.32e-28	41	354	31	335	Probable polygalacturonase At3g15720
177865	PLN02218	1.03e-26	41	351	75	383	polygalacturonase ADPG
215120	PLN02188	1.81e-23	41	391	44	389	polygalacturonase/glycoside hydrolase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABD61571.1|GH28	9.35e-292	1	406	1	406
CAK47977.1|GH28	9.35e-292	1	406	1	406
CAC07733.1|GH28|3.2.1.-	1.42e-286	1	406	1	406
CAB65657.1|GH28|3.2.1.-	1.42e-286	1	406	1	406
BCR96790.1|GH28	6.40e-267	1	406	1	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	2.44e-279	19	406	1	388	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1NHC_A	1.40e-35	54	400	12	336	Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_B Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_C Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_D Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_E Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger],1NHC_F Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger [Aspergillus niger]
1IA5_A	1.99e-32	98	400	51	339	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]
6KVE_A	3.03e-32	34	400	8	344	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
6KVH_A	3.03e-32	34	400	8	344	Chain A, endo-polygalacturonase [Evansstolkia leycettana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QK83|XGHA_ASPNC	1.66e-292	1	406	1	406	Probable endo-xylogalacturonan hydrolase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=xghA PE=3 SV=1
sp|Q9UUZ2|XGHA_ASPTU	2.53e-287	1	406	1	406	Endo-xylogalacturonan hydrolase A OS=Aspergillus tubingensis OX=5068 GN=xghA PE=1 SV=1
sp|B8NPS8|XGHA_ASPFN	5.06e-218	6	406	6	406	Probable endo-xylogalacturonan hydrolase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=xghA PE=3 SV=1
sp|Q2UBD8|XGHA_ASPOR	1.68e-216	6	406	6	406	Probable endo-xylogalacturonan hydrolase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xghA PE=3 SV=1
sp|A1DBT5|XGHA_NEOFI	3.74e-213	1	406	1	406	Probable endo-xylogalacturonan hydrolase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xghA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000261	0.999700	CS pos: 25-26. Pr: 0.9180

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_1126871-t41_1-p1.