CAZyme Information: ASPNIDRAFT2_1123700-t41_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: ASPNIDRAFT2_1123700-t41_1-p1
• CAZy Family: CE5
• CAZyme Description: Glycoside Hydrolase Family 3 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
856	ACJE01000013.1|CGC3	94376.70	5.6089

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC1015	11910	380704	6	11904

• Gene Location: location=ACJE01000013.1:16229-19102(-)

Full Sequence      

MDLEVILRSLTLPEKVTLLAGASTWRTAPVPRVNIPHLKLSDGPSGARGEIFGDSVPAAF
FPSGTSLGATWDEDLLGELGQILAEECKSKSASVILGPTMCIHRHPLGGRNFESYSEDPY
LTGRLATATIRGIQSRGIGATAKHYVANDQETDRFHYNAVIPTRALREVYLRPFQMVVRD
ANPWCLMTAYNRVNGAHCDENVELLTDILRKEWGWEGVAMSDWGGAHDAAQSLVAGLDLE
MPGPPVRRTWEIVQQYLADSKITEADVDRSVHRILRLLKRTKRFENDSEHPETTLRNSNN
TARLLHAAQSGIVLLKNEAGCLPLWPSEGLERVGIFGPNSARVVAGGGGSSYIKAPYWTN
VDDSLTARFQDTTTEIVRNVGAKVNRYLPAITLAATRNPDTGGQGAAIDWFSGHDLSGQP
TETIHTDDLYYINFGNTPQTIATETGFSFRLRTTIVPLTTGTHRLSLASIGPSKLYISGQ
LMAHQDGNFEKRGTLFFTYGSHEAIFTLDMVAGQEYHVEIEYWSHDRQLSAELLPRMDPM
EDKFQGVRLGYEEANRRDLPSEAAKQARDCEAAVVVVGRDREWETEGQDVPMFALPGEQV
RLIEEVAAVCARTIVVIQSGTPVQLEPWIENVKGVVCAWYQGQELGNATASVVCGEFNPS
GRLPMTWPRRLEECPAFSSFRVEAHEIQYAEGIYVGGRWWDLLGTQPMYPLGYGLSYNTF
ALRIVHPEQLAMVTGPQPVQVIVEVTHRGDGAVGLPGRETVIAWCEVVDSGNGRLARPPK
QVSAFAKSPLLAPGETCTVSLSITAYELGVYDPERQKWVLDKGAQFRILVGADAAHTQKA
GTIHVPETITWVHRLD

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	29	242	3.4e-66	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.67e-64	31	380	56	395	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.62e-47	546	696	67	215	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
185053	PRK15098	2.32e-46	61	840	120	760	beta-glucosidase BglX.
395747	Glyco_hydro_3	4.52e-39	46	277	76	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	9.81e-36	10	732	60	649	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS07145.1|GH3	0.0	2	852	11	855
BCR94550.1|GH3	0.0	2	852	11	855
AEO53892.1|GH3	2.69e-203	7	852	60	883
AEO66128.1|GH3	8.55e-203	7	852	63	887
EGX50909.1|GH3	5.67e-201	3	851	20	843

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.46e-152	2	851	5	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.44e-148	2	851	5	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.41e-109	2	849	4	672	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.57e-97	10	834	12	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.90e-96	6	847	7	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	6.83e-170	2	831	10	824	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|Q5BA18|BGLK_EMENI	1.56e-169	2	851	12	835	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|P27034|BGLS_RHIRD	1.93e-157	3	846	2	811	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.13e-154	2	852	5	836	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	2.52e-153	1	852	4	837	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999976	0.000056

TMHMM  Annotations     

There is no transmembrane helices in ASPNIDRAFT2_1123700-t41_1-p1.